Search by BoMiProt ID - Bomi5081


Primary Information

BoMiProt ID Bomi5081
Protein Name Deoxynucleotidyltransferase terminal-interacting protein 2
Organism Bos taurus
Uniprot IdQ0P5H2
Milk FractionWhey
Ref Sequence Id NP_001068974.1
Aminoacid Length 766
Molecular Weight 86798
Fasta Sequence https://www.uniprot.org/uniprot/Q0P5H2.fasta
Gene Name DNTTIP2
Gene Id 511258
Protein Existence Status reviewed

Secondary Information

Protein Function  involved in chromatin remodeling and gene transcription.The encoded nuclear protein binds to and enhances the transcriptional activity of the estrogen receptor alpha, and also interacts with terminal deoxynucleotidyltransferase. The expression profile of this gene is a potential biomarker for chronic obstructive pulmonary disease.
PTMs phosphorylation,ubl conjugation,Isopeptide bond formation.
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0P5H2|TDIF2_BOVIN Deoxynucleotidyltransferase terminal-interacting protein 2 OS=Bos taurus OX=9913 GN=DNTTIP2 PE=2 SV=1 MVVTRSARPQARNEATSVESLRQKNSAVTRLHVHPKGRKGSSPDNPNTTESQTTPERSPA PKTRKSGTTGSLPEMNKPATDGEISEAESDCSSVPEVQDPVFRVTRRRQILVAGTPVSSV RKRLKIT*127RVSESHTEEVVS*139EADS*143HVS*146GISRIMPPTEITTRRSKAKSQREPKQESHVEVIS*180DAESSCSDIS*190FSGIATRRTTRSMQRKLQAQTEENNTKIVLENEKEIIHT*229PVNLEDS*236VNRR TSRLLARS*248LS*250QINKPNFS*258NNEIYNDPDDSFFGISGKKLAVKKTRNFTIREEKQDSISPLK EITKQNCKSLDEEAKKIIDGGKEGNEKNSQLNLS*334EFQDTGLQQLVSQRHSTPESDKTTSE SSTLNHEAVMKSLAQTFAVVEMDRWNEERKNAIKTSDCSEPGDGSYSDSDEECTVIGVSE DMSKEKEVDSESDTKPSNLEFNTTQDKDDSVLLVLSSDESQQSEHSENEEDTVCFVENNG NKESLNGDSENLSHDNALFVIDTTPGLSADKNFYLDEEDKAGEVATEEEEEEEEEESEEE LSDHDRNKDNEFSDEDNLLSNTKSKLLKLMSSSIDTGLNIKELGGLYINFNADKVQLNKR TLTQMKEKRKDELLQKTVIT*620PEFEKNYCVPPYSESKYKLQKKRRQERQKTAGDGWFGMKA PELTDELKNDLKALKMRASMDPKRFYKKNDRDGFPKYFQIGTIVDNPADFYHSRVPKKQR KRTIVEELLADSEFRRYNRRKYSEIMAEKAANAAGKKFRKKKKFRN
Predicted Disorder Regions 18-25, 42-122, 155-187, 327-353, 381-556, 750-765
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Fujita K, Shimazaki N, Ohta Y, Kubota T, Ibe S, Toji S, Tamai K, Fujisaki S, Hayano T, Koiwai O. Terminal deoxynucleotidyltransferase forms a ternary complex with a novel chromatin remodeling protein with 82 kDa and core histone. Genes Cells. 2003 Jun;8(6):559-71. doi: 10.1046/j.1365-2443.2003.00656.x. PMID: 12786946.