Search by BoMiProt ID - Bomi5080


Primary Information

BoMiProt ID Bomi5080
Protein Name Deoxynucleotidyltransferase terminal-interacting protein 1/Terminal deoxynucleotidyltransferase-interacting factor 1/TdIF1/TdT-interacting factor 1
Organism Bos taurus
Uniprot IdA6H7A8
Milk Fractionwhey
Ref Sequence Id NP_001092346.1
Aminoacid Length 329
Molecular Weight 37012
Fasta Sequence https://www.uniprot.org/uniprot/A6H7A8.fasta
Gene Name DNTTIP1/TDIF1
Gene Id 505524
Protein Existence Status Reviewed

Secondary Information

Protein Function Enhances the DNA polymerase activity.Increases DNTT terminal deoxynucleotidyltransferase activity (in vitro). Also acts as a transcriptional regulator, binding to the consensus sequence 5'-GNTGCATG-3' following an AT-tract. Associates with RAB20 promoter and positively regulates its transcription.
Biochemical Properties Identified in a histone deacetylase complex that contains DNTTIP1, HDAC1 and MIDEAS; this complex assembles into a tetramer that contains four copies of each protein chain.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6H7A8|TDIF1_BOVIN Deoxynucleotidyltransferase terminal-interacting protein 1 OS=Bos taurus OX=9913 GN=DNTTIP1 PE=2 SV=1 MGATGDVEQPRGPGGAERGGPELGDAGAAGQLVLTNPWNIMIKHRQVQRRGRRSQMTTSF TDPAISMDLLRAVLQPSINEEIQTVFNKYMKFFQKAALNVRDNVGEEVDAEQLIQEACRS CLEQAKLLFSDGEKVIPRLTHELPGIKRGRQAEEECALRGS*162PIPKKRKGRPPGHILANDR AATGMVWKPKSCEPIRREGPKWDPARLNESTTFVLGSRANKALGMGGTRGRIYIKHPHLF KYAADPQDKHWLAEQHHMRATGGKMAYLLIEEDIRDLAASDDYRGCLDLKLEELKSFVLP SWMVEKMRKYMETLRTENEHRAVEAPPQT
Predicted Disorder Regions 1-29, 44-60, 142-205, 317-329
DisProt Annotation
TM Helix Prediction no TM helices
Additional Comments DNTTIP1 knockdown (siDNTTIP1) cells showed depressed cellular proliferation by cell-cycle arrest at the G1 phase with high acetylation of p53 and upregulation of p21Cip1.DNTTIP has two isoforms, DNTTIP1 and DNTTIP2.
Bibliography Sawai, Y., Kasamatsu, A., Nakashima, D., Fushimi, K., Kasama, H., Iyoda, M., Kouzu, Y., Shiiba, M., Tanzawa, H., & Uzawa, K. (2018). Critical role of deoxynucleotidyl transferase terminal interacting protein 1 in oral cancer. Laboratory investigation; a journal of technical methods and pathology, 98(8), 980–988. https://doi.org/10.1038/s41374-018-0070-3