Search by BoMiProt ID - Bomi5071


Primary Information

BoMiProt ID Bomi5071
Protein Name Density-regulated protein
Organism Bos taurus
Uniprot IdQ2HJ47
Milk FractionExosomes
Ref Sequence Id NP_001039993.1
Aminoacid Length 198
Molecular Weight 22217
Fasta Sequence https://www.uniprot.org/uniprot/Q2HJ47.fasta
Gene Name DENR
Gene Id 614238
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells tongue muscle
Protein Function It may be involved in the translation of target mRNAs by scanning and recognition of the initiation codon. Involved in translation initiation; promotes recruitment of aminoacetyled initiator tRNA to P site of 40S ribosomes. 
PTMs Phosphorylation at Serine,N-acetylation at Alanine
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2HJ47|DENR_BOVIN Density-regulated protein OS=Bos taurus OX=9913 GN=DENR PE=2 SV=1 MAADISESGGHDCRGDQRSNTKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKN FPNEFAKLTVENSPKQEAGISEGQGT*86AGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKI PRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQE KWPEVDDDS*189IEDLGEVKK
Predicted Disorder Regions 1-26, 68-125, 188-198
DisProt Annotation
TM Helix Prediction No TM helices