Search by BoMiProt ID - Bomi5043


Primary Information

BoMiProt ID Bomi5043
Protein Name Dehydrogenase/reductase SDR family member 4/NADPH-dependent carbonyl reductase/NADP-retinol dehydrogenase/NADPH-dependent retinol dehydrogenase/reductase/Peroxisomal short-chain alcohol dehydrogenase
Organism Bos taurus
Uniprot IdQ8SPU8
Milk FractionWhey,MFGM
Ref Sequence Id NP_777247.2
Aminoacid Length 279
Molecular Weight 29440
Fasta Sequence https://www.uniprot.org/uniprot/Q8SPU8.fasta
Gene Name DHRS4/NDRD
Gene Id 281360
Protein Existence Status reviewed

Secondary Information

Protein Function metabolism of several aromatic carbonyl compounds, steroids, and bile acids.
Biochemical Properties tetrameric protein, two subunits are connected via an intermolecular disulfide bridge that is formed by N-terminal cysteine residues (Cys5) of each protein chain, which increases the enzymatic activity.consists of a 7-stranded β-sheet, surrounded by three α-helices on either side.The core is defined by a Rossmann-fold, built of two βαβαβ-motifs (βA-αB-βB-αC-βC and βD-αE-βE-αF-βF). The cofactor is positioned in a deep cleft above the β-sheets. This central motif is C terminally extended through a seventh β-sheet (βG) and one α-helix (αG), separated from the Rossmann-motif through a left-handed helix-turn-helix motif built out of two small helices (αFG1 und αFG2).
PTMs Acetylation and phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q8SPU8|DHRS4_BOVIN Dehydrogenase/reductase SDR family member 4 OS=Bos taurus OX=9913 GN=DHRS4 PE=2 SV=2 MLKVGLPLGACARSWKSVRMASCGMARRNPLDNKVALVTASTDGIGFAIARRLAQDGAHV VVSSRKQQNVDRAVATLKGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGVDILISNAAV SPFFGSLMDVPEEVWDKILDVNVKATALLTKAVVPEMAKRGGGSIVIVSSIAAYSPFPSL GPYNVSKTALLGLTKNLALELAESNVRVNCLAPGLIRTSFS*221RVLWEDPARQESIKATFQI KRIGKPEECAGIVSFLCSEDASYITGETVVVAGGSLSHL
Predicted Disorder Regions 2 disordered segments; 1-6, 14-20
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Kisiela M, Faust A, Ebert B, Maser E, Scheidig AJ. Crystal structure and catalytic characterization of the dehydrogenase/reductase SDR family member 4 (DHRS4) from Caenorhabditis elegans. FEBS J. 2018 Jan;285(2):275-293. doi: 10.1111/febs.14337. Epub 2017 Nov 28. PMID: 29151266.