Primary Information |
|---|
| BoMiProt ID | Bomi5043 |
|---|
| Protein Name | Dehydrogenase/reductase SDR family member 4/NADPH-dependent carbonyl reductase/NADP-retinol dehydrogenase/NADPH-dependent retinol dehydrogenase/reductase/Peroxisomal short-chain alcohol dehydrogenase |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q8SPU8 |
|---|
| Milk Fraction | Whey,MFGM |
|---|
| Ref Sequence ID | NP_777247.2 |
|---|
| Aminoacid Length | 279 |
|---|
| Molecular Weight | 29440 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | DHRS4/NDRD |
|---|
| Gene ID | 281360 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | metabolism of several aromatic carbonyl compounds, steroids, and bile acids. |
|---|
| Biochemical Properties | tetrameric protein, two subunits are connected via an intermolecular disulfide bridge that is formed by N-terminal cysteine residues (Cys5) of each protein chain, which increases the enzymatic activity.consists of a 7-stranded β-sheet, surrounded by three α-helices on either side.The core is defined by a Rossmann-fold, built of two βαβαβ-motifs (βA-αB-βB-αC-βC and βD-αE-βE-αF-βF). The cofactor is positioned in a deep cleft above the β-sheets. This central motif is C terminally extended through a seventh β-sheet (βG) and one α-helix (αG), separated from the Rossmann-motif through a left-handed helix-turn-helix motif built out of two small helices (αFG1 und αFG2). |
|---|
| PTMs | Acetylation and phosphorylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q8SPU8|DHRS4_BOVIN Dehydrogenase/reductase SDR family member 4 OS=Bos taurus OX=9913 GN=DHRS4 PE=2 SV=2
MLKVGLPLGACARSWKSVRMASCGMARRNPLDNKVALVTASTDGIGFAIARRLAQDGAHV
VVSSRKQQNVDRAVATLKGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGVDILISNAAV
SPFFGSLMDVPEEVWDKILDVNVKATALLTKAVVPEMAKRGGGSIVIVSSIAAYSPFPSL
GPYNVSKTALLGLTKNLALELAESNVRVNCLAPGLIRTSFS*221RVLWEDPARQESIKATFQI
KRIGKPEECAGIVSFLCSEDASYITGETVVVAGGSLSHL
|
|---|
| Predicted Disorder Regions | 2 disordered segments; 1-6, 14-20 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | Kisiela M, Faust A, Ebert B, Maser E, Scheidig AJ. Crystal structure and catalytic characterization of the dehydrogenase/reductase SDR family member 4 (DHRS4) from Caenorhabditis elegans. FEBS J. 2018 Jan;285(2):275-293. doi: 10.1111/febs.14337. Epub 2017 Nov 28. PMID: 29151266. |
|---|
