Search by BoMiProt ID - Bomi5023


Primary Information

BoMiProt ID Bomi5023
Protein Name D-aminoacyl-tRNA deacylase 1/DNA-unwinding element-binding protein B/Gly-tRNA(Ala) deacylase
Organism Bos taurus
Uniprot IdQ2T9V8
Milk FractionExosomes,MFGM
Ref Sequence Id NP_001033193.1
Aminoacid Length 209
Molecular Weight 23232
Fasta Sequence https://www.uniprot.org/uniprot/Q2T9V8.fasta
Gene Name DTD1
Gene Id 514493
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells  granulosa cell 
Protein Function d-aminoacyl-tRNA-deacylase (DTD) prevents the incorporation of d-amino acids into proteins during translation by hydrolyzing the ester bond between mistakenly attached amino acids and tRNAs.
Biochemical Properties The Gly137-Pro138 motif is conserved in DTDs, being crucial for providing enantioselectivity to the enzyme.
PTMs Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2T9V8|DTD1_BOVIN D-aminoacyl-tRNA deacylase 1 OS=Bos taurus OX=9913 GN=DTD1 PE=2 SV=1 MKAVVQRVTRASVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESG KHWSKSVMDKQYEVLCVSQFTLQCVLKGNKPDFHLAMPAEQAESFYKGFLEQLRKAYRPE LVKDGKFGAYMQVHIQNDGPVTIELESPAPGAAASDPKQLSKLEKQQQRKEKTRAKGPSE SSKERSAPRKEDRSASS*197GAEGDVS*204S*205EREP
Predicted Disorder Regions 149-209
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylation in the C-terminus weakens the interaction with CDC45
Bibliography 1.Ilchenko MM, Rybak MY, Rayevsky AV, Kovalenko OP, Dubey IY, Tukalo MA. Substrate-assisted mechanism of catalytic hydrolysis of misaminoacylated tRNA required for protein synthesis fidelity. Biochem J. 2019 Feb 28;476(4):719-732. doi: 10.1042/BCJ20180910. PMID: 30718305. 2.Pawar KI, Suma K, Seenivasan A, Kuncha SK, Routh SB, Kruparani SP, et al. Role of Daminoacyl-tRNA deacylase beyond chiral proofreading as a cellular defense against glycine mischarging by AlaRS. eLife. 2017;6.