Search by BoMiProt ID - Bomi5016


Primary Information

BoMiProt ID Bomi5016
Protein Name D site-binding protein/Albumin D box-binding protein/Albumin D-element-binding protein
Organism Bos taurus
Uniprot IdQ32PF6
Milk FractionWhey
Ref Sequence Id NP_001032522.1
Aminoacid Length 325
Molecular Weight 34322
Fasta Sequence https://www.uniprot.org/uniprot/Q32PF6.fasta
Gene Name DBP
Gene Id 503577
Protein Existence Status reviewed

Secondary Information

Protein Function recognizes and binds to the sequence 5'-RTTAYGTAAY-3' found in the promoter of genes such as albumin,CYP2A4 and CYP2A5.
Biochemical Properties Binds DNA as a homodimer or a heterodimer
PTMs Phosphorylation 
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q32PF6|DBP_BOVIN D site-binding protein OS=Bos taurus OX=9913 GN=DBP PE=2 SV=2 MARPVSERTPAPLLLGGPTGAPPGGGALLGLRSLLQGTSKPKEPTSCLLKEKERKASPPA ATVPGPGLETAGPADASAGAVVGGGS*86PRGRPGAAPGPGLLAPLLWERTLPFGDVEYVDLD AFLLEHGLPPSPPPPGGPSPAPSPVRTPAPSPRPGSCGSASPRSSPGHAPARAALGAAGG HRAGLTSRDTPSPVDPDTVEVLMTFEPDPADLALSSIPGHETFDPRRHRFSEEELKPQPI MKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQE VVAVRQELSHYRAVLSRYQAQHGAL
Predicted Disorder Regions 2 disordered segments; (2-112), (120-278)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylation on Ser