Search by BoMiProt ID - Bomi5009


Primary Information

BoMiProt ID Bomi5009
Protein Name Cytosolic purine 5'-nucleotidase/Cytosolic 5'-nucleotidase II/Cytosolic IMP/GMP-specific 5'-nucleotidase
Organism Bos taurus
Uniprot IdO46411
Milk FractionWhey
Ref Sequence Id NP_776830.1
Aminoacid Length 560
Molecular Weight 64841
Fasta Sequence https://www.uniprot.org/uniprot/O46411.fasta
Gene Name NT5C2
Gene Id 281951
Protein Existence Status reviewed

Secondary Information

Protein Function  purine nucleotide degradation.dephosphorylation of the 5′-nucleoside monophosphates.
Biochemical Properties timulated by nucleoside triphosphates, among them ATP and GTP, and inhibited by Pi.Binds 1 Mg2+ ion per subunit
PTMs phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|O46411|5NTC_BOVIN Cytosolic purine 5'-nucleotidase OS=Bos taurus OX=9913 GN=NT5C2 PE=1 SV=1 MTTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMDYTLAVY KSPEYESLGFELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLV CAHGFNFIRGPETREQYPNKFIQRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTS CETGFKDGDLFMSYRSMFQDVRDAVDWVHYKGSLKEKTVENLEKYVVKDGKLPLLLSRMK EVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQSYFDLILVDARKPLFFGEGT VLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTVCDLLGAKGKDILYIGDHIFGDILKS KKRQGWRTFLVIPELAQELHVWTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISS*418IQ RRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAA HVLMPHESTVEHTHVDINEMES*502PLATRNRTS*511VDFKDTDYKRHQLTRS*527ISEIKPPNLFPLA PQEITHCHDEDDDEEEEEEE
Predicted Disorder Regions 544-560
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Allegrini S, Pesi R, Tozzi MG, Fiol CJ, Johnson RB, Eriksson S. Bovine cytosolic IMP/GMP-specific 5'-nucleotidase: cloning and expression of active enzyme in Escherichia coli. Biochem J. 1997 Dec 1;328 ( Pt 2)(Pt 2):483-7. doi: 10.1042/bj3280483. PMID: 9371705; PMCID: PMC1218945. 2.Van den Berghe G, Bontemps F, Vincent MF. Cytosolic purine 5'-nucleotidases of rat liver and human red blood cells: regulatory properties and role in AMP dephosphorylation. Adv Enzyme Regul. 1988;27:297-311. doi: 10.1016/0065-2571(88)90023-4. PMID: 2854949.