Search by BoMiProt ID - Bomi5004


Primary Information

BoMiProt ID Bomi5004
Protein Name Cytoskeleton-associated protein 2-like/Radial fiber and mitotic spindle protein/Radmis
Organism Bos taurus
Uniprot IdA5PK21
Milk FractionWhey
Ref Sequence Id NP_001092371.1
Aminoacid Length 744
Molecular Weight 82608
Fasta Sequence https://www.uniprot.org/uniprot/A5PK21.fasta
Gene Name CKAP2L
Gene Id 507498
Protein Existence Status Reviewed

Secondary Information

Protein Function for proper mitotic spindle formation and cell cycle progression
Biochemical Properties 745-amino acid protein has a calculated molecular mass of 84 kD.ontains a KEN degradation motif near the N terminus.D-box and KEN-box- are important for binding to APC/C-cdh1 complex.
Significance in milk found to be upregulated during early lactational stage
PTMs phosphorylation .Ubl conjugation by APC/C
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A5PK21|CKP2L_BOVIN Cytoskeleton-associated protein 2-like OS=Bos taurus OX=9913 GN=CKAP2L PE=2 SV=1 MVRPGLSAAAEERQRKLQEYLAAKGKLKCQNTKPYLKAKNNCPNPPHSKSTIGPKKDVTN HVALPVKTTRSINIKLQSRPANITRSQRPKLEPPKLGKRLTSESVSSNPNGKPPGNSQQL RGFGSSTDGKQPRKTMGSLNVQKLKTTKQQVTDQRTAKGTDPVDNTHVENESLGGCLKEM NKENLPQDLPNSERKPNPESWTINKPQTNQTKSSLASTREVLDKSSVNSAALKEGVIKPF VEETQISVPPGKSQKLSRVADLIRPGGKPPKTLPSHFVQTLNRTQATKKTVVKDIKSIKV NRSKYERPNEAKLQSYTVTEQKVKHSKPSTHPSVLQGGCNHRHPNIKQDHKPTQACCRPQ TSYALQKSKAISQRPNLTVGSFNSVIPSTPSIRANGATGNKCNNSCQQRARTLDSKFKSA PPQKCFLNKTAPRTQAGGPTISGRGVPNGAQTNPCKKIAAEDRRKQLEEWRKSKGKIYKR PPMELKTKRKIIEEMNISFWKSMEKEEEEKKAQLELSNKINNTLTECLQLIERGVLSNEV FAILSSIPEAEKFAKFWICKAKLLASKGTFDVIGLYEEAIRNGATPIQELREVVLNILQD RNRTTEGMTSNSLVAETNITSIEELAKKTESGASCLSPKESEQMSVTPQITKSEQDGHPG IKLQIAPIPRINGMPEVQDMKLITPVRRSARIERAVSRYPEMLQEHDLVVASLNELLEVE ETECFIFRKNEALPVTLGFPVSES*744
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs CKAP2 is phosphorylated on T596 during early phases of mitosis (i.e., prophase, prometaphase, and metaphase), and its de-phosphorylation is initiated at some point during metaphase to anaphase transition.CKAP2 is a physiological substrate of APC/C during mitotic exit and polyubiqitinated by APC/C.The levels of CKAP2 fluctuated across the cell cycle in culture cells, high in mitosis and low during mitotic exit.
Additional Comments The c.571dupA CKAP2L mutation was associated with the congenital disease Filippi syndrome.CKAP2L mutation is related to defects in the spindle tissue, including mitotic spindle defects, chromosome hysteresis, and other mitotic instability characteristics, that are involved in the formation and development of cancer
Bibliography 1.Wang P, He X. Oncogenic and prognostic role of CKAP2L in hepatocellular carcinoma. Int J Clin Exp Pathol. 2020 May 1;13(5):923-933. PMID: 32509063; PMCID: PMC7270663. 2.Zhu L, Zheng Y, Hu R, Hu C. CKAP2L, as an Independent Risk Factor, Closely Related to the Prognosis of Glioma. Biomed Res Int. 2021 Sep 28;2021:5486131. doi: 10.1155/2021/5486131. PMID: 34631884; PMCID: PMC8494202. 3.Hong, K., Choi, YB., Lee, JH. et al. Transient phosphorylation of tumor associated microtubule associated protein (TMAP)/cytoskeleton associated protein 2 (CKAP2) at Thr-596 during early phases of mitosis. Exp Mol Med 40, 377–386 (2008). https://doi.org/10.3858/emm.2008.40.4.377 4.Seki A, Fang G. CKAP2 is a spindle-associated protein degraded by APC/C-Cdh1 during mitotic exit. J Biol Chem. 2007 May 18;282(20):15103-13. doi: 10.1074/jbc.M701688200. Epub 2007 Mar 21. PMID: 17376772.