Search by BoMiProt ID - Bomi5003


Primary Information

BoMiProt ID Bomi5003
Protein Name Cytoskeleton-associated protein 2
Organism Bos taurus
Uniprot IdA5D7U0
Milk FractionWhey
Ref Sequence Id NP_001091501.1
Aminoacid Length 625
Molecular Weight 70085
Fasta Sequence https://www.uniprot.org/uniprot/A5D7U0.fasta
Gene Name CKAP2
Gene Id 515249
Protein Existence Status reviewed

Secondary Information

Presence in other biological fluids/tissue/cells found in retinal capillary endothelial cells
Protein Function plays important role in cell proliferation.Involved in regulating aneuploidy, cell cycling, and cell death in a p53/TP53-dependent manner
Biochemical Properties Associates with alpha- and beta-tubulins.
Significance in milk Cytoskeletal protein
PTMs Phosphorylation on Ser and Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A5D7U0|CKAP2_BOVIN Cytoskeleton-associated protein 2 OS=Bos taurus OX=9913 GN=CKAP2 PE=2 SV=1 MSTPAIPQDLQLNPSQRTQSAFREQRRQKLKEHLLKRKTSFACKQENQMLLSDGDQRVRT SEGQIQEGKKVLKIKTEMADKENVGRPTGIKNNLTVEKNCIPLKPSNELTNSTLATDPPN SEDNNQTLPLLPVKDDPQSQHRTLSQTFHLKNNSKKKPVITEKPKHDANVPKKPVLGAYR GQIVQSKINS*190FRKPLQVKDESSATTKKLPATVSKATKPQPGDVSSITVKSDRASHMTSTT KFASTTSQIRHLVRPPIRSQHNKAQDAMKPGNSRMSANVTVQKGPREKELNTVLSGIKTS SSQDIKGDKTLSKSMAAGMVVRPASSSNTKLIEKSKSAGQRSHTTVKAAVDSRWTQPKET AEERKARLSEWKAGKGRILKRPPSSAVTRPEPETQNEQPVGSFWTTMAEEDEQRLFTEKV NKTFSECLNLINEPIEEMRHTIVDILTRKSQEKLKFGENIEETSAAEEKIQEAHTDDTGV DLESGKLEMENNPPRNVFQDCEKEQDDKVKDPTSDVKT*518PST*521NTRAGCLIKYNVS*534T*535T*536PY*538LQS*541VKKKMQFDETNSAYKELKFLTPVRRSRRLQEKTSKLPDMLKDHYPCVSSLEQLTELGCE TDAFVCRPNTALCGMFSEPDPTEEE
Predicted Disorder Regions 11 predicted disorder segments ;(3rd residue),(38-41),(105-111),(125-139),(154-166),(196-238),(299-345),(362-376),(403-410),(460-523),(616-623)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Zhang S, Wang Y, Chen S, Li J. Silencing of cytoskeleton-associated protein 2 represses cell proliferation and induces cell cycle arrest and cell apoptosis in osteosarcoma cells. Biomed Pharmacother. 2018 Oct;106:1396-1403. doi: 10.1016/j.biopha.2018.07.104. Epub 2018 Jul 23. PMID: 30119212.