Search by BoMiProt ID - Bomi4975


Primary Information

BoMiProt ID Bomi4975
Protein Name Cysteine-rich secretory protein LCCL domain-containing 2
Organism Bos taurus
Uniprot IdA6QLZ7
Milk FractionWhey,MFGM
Ref Sequence Id NP_001093769.1
Aminoacid Length 496
Molecular Weight 55581
Fasta Sequence https://www.uniprot.org/uniprot/A6QLZ7.fasta
Gene Name CRISPLD2
Gene Id 505329
Protein Existence Status reviewed

Secondary Information

Protein Function A lipopolysaccharide-binding serum protein thought to have an anti-inflammatory function.Take part in extra cellular matrix assembly,Binds to heparin, dermatan sulfate and chondroitin sulfate
Biochemical Properties two LCCL-domains of human CRISPLD2 protein, a lipopolysaccharide-binding serum protein involved in defense against endotoxin shock, have higher affinity for the lipid A, the toxic moiety of lipopolysaccharides than for lipopolysaccharide
Significance in milk immune function.It can bind to LPS, a major structural component of Gram-negative bacterial cell walls, and is thought to have an anti-inflammatory function.only present in colostrum
PTMs N linked glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6QLZ7|CRLD2_BOVIN Cysteine-rich secretory protein LCCL domain-containing 2 OS=Bos taurus OX=9913 GN=CRISPLD2 PE=2 SV=1 MSCVLTGVVPLGLVLLLCGAQGFFLPN*27VTQLEKLLSKYQGDQPHSRTRRAISRADREEIL TLHNKLRGQVSPPASNMEYMTWDEELEKSAVAWARECIWEHGPTSLLVSIGQNLAVHWGR PRSPGSHVQSWYDEVKDYTYPYPHECNPWCPERCSGPMCTHYTQIVWATTNRIGCAVNTC PRMNVWGDVWENAVYLVCNYFPKGNWIGEAPYKTGQPCSECPGKYRGGCKNNLCYQETYG QETETDDMNEVEAAPIPDEKHVWVTPRVIKPKKPKKDSPVNYMTQVVKCDTKMKDKCKGS TCNRYQCPAGCLHSGAKIFGTLFYESASSICRAAIHYGILDDRGGLVDVTRNGKVPFFVK SERNGVQSLSKYKASSSFTVSKVKVQDLDCYTTVAQLCPYEKPGTHCPRVRCPAHCKDEP SYWAPVFGSNIYADTSSICKTAVHAGVIRNESGGYVDVMPVDKKKTYVASLRNGVQSESL RTPRDGKAFRIFAVRQ
Predicted Disorder Regions 3 predicted disordered segments;(41-50),(247-253),(265-281)
DisProt Annotation
TM Helix Prediction 1TMH; (7-25)
Bibliography 1.Cheng, Z., Oguejiofor, C. F., Swangchan-Uthai, T., Carr, S., & Wathes, D. C. (2015). Relationships between Circulating Urea Concentrations and Endometrial Function in Postpartum Dairy Cows. Animals : an open access journal from MDPI, 5(3), 748–773. https://doi.org/10.3390/ani5030382 2.Vásárhelyi V, Trexler M, Patthy L. Both LCCL-domains of human CRISPLD2 have high affinity for lipid A. Biochimie. 2014 Feb;97:66-71. doi: 10.1016/j.biochi.2013.09.021. Epub 2013 Oct 1. PMID: 24090571.