Search by BoMiProt ID - Bomi4972


Primary Information

BoMiProt ID Bomi4972
Protein Name Cysteine-rich protein 2
Organism Bos taurus
Uniprot IdQ0VFX8
Milk FractionWhey
Ref Sequence Id NP_001073117.1
Aminoacid Length 208
Molecular Weight 22634
Fasta Sequence https://www.uniprot.org/uniprot/Q0VFX8.fasta
Gene Name CRIP2
Gene Id 780821
Protein Existence Status Reviewed

Secondary Information

Protein Function Binding of CRP2 to F-actin accelerates actin polymerization and F-actin cluster formation.
Biochemical Properties It consists of two LIM domains, which are double zinc-finger-like structures that mediate protein-protein interactions, and two glycine-rich regions.CRP family members (CRP1, CRP2/SmLIM, and CRP3/MLP) share a highly sequence homology, but their expression patterns differ depending on the type of tissue.
PTMs N6-Acetylation at Lys, Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q0VFX8|CRIP2_BOVIN Cysteine-rich protein 2 OS=Bos taurus OX=9913 GN=CRIP2 PE=2 SV=1 MASKCPKCDKTVYFAEKVSSLGKDWHRFCLRCEHCSKTLTPGGHAEHDGKPFCHKPCYAT LFGPKGVNIGGAGSYIYEKPSAEKPQVTGPIEVPVARTEERKAS*104GPPKGPSKASSVTTFT GEPNMCPRCNKRVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYG ILFGPKGVNTGAVGSYIYDKDPEGKAQP
Predicted Disorder Regions 85-95, 99-120, 198-208
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Kihara T, Sugimoto Y, Shinohara S, Takaoka S, Miyake J. Cysteine-rich protein 2 accelerates actin filament cluster formation. PLoS One. 2017 Aug 16;12(8):e0183085. doi: 10.1371/journal.pone.0183085. PMID: 28813482; PMCID: PMC5558965. 2.Weiskirchen R, Gunther K. The CRP/MLP/TLP family of LIM domain proteins: acting by connecting. Bioessays. 2003;25(2):152–162. doi: 10.1002/bies.10226.