Search by BoMiProt ID - Bomi4968


Primary Information

BoMiProt ID Bomi4968
Protein Name Cysteine and histidine-rich domain-containing protein 1/CHORD domain-containing protein 1
Organism Bos taurus
Uniprot IdQ29RL2
Milk FractionExosomes
Ref Sequence Id NP_001039377.1
Aminoacid Length 332
Molecular Weight 37427
Fasta Sequence https://www.uniprot.org/uniprot/Q29RL2.fasta
Gene Name CHORDC1
Gene Id 505144
Protein Existence Status Reviewed

Secondary Information

Protein Function Morgana/CHP-1 is a ubiquitously expressed protein able to inhibit ROCK II kinase activity. 
PTMs N-Acetylation at Ala,Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q29RL2|CHRD1_BOVIN Cysteine and histidine-rich domain-containing protein 1 OS=Bos taurus OX=9913 GN=CHORDC1 PE=2 SV=1 MALLCYNRGCGQRFDPETNSDDACTYHPGVPVFHDALKGWSCCKRRT*47TDFS*51DFLSIVGCT KGRHNSEKPPEPVKPEVKTTEKKELSELKPKFQEHIIQAPKPVEAIKRPSPDEPMTNLEL KISASLKQALDKLKLSSGNEENKKEEDSDEIKIGTSCKNGGCSKTYQGPQSLEEVCVYHS GVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTTGKHMWTKKDAGKKVVPCRHDWHQTGGE VTISVYAKNSLPELSQVVANSTLLNVHIVFEGEKEFHQNVKLWGVIDVKRSYVTMTATKI EITMRKAEPMQWASLELPAAKTEEKQKEETTE
Predicted Disorder Regions 16-29, 61-154, 216-227, 313-332
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Fusella F, Ferretti R, Recupero D, Rocca S, Di Savino A, Tornillo G, Silengo L, Turco E, Cabodi S, Provero P, Pandolfi PP, Sapino A, Tarone G, Brancaccio M. Morgana acts as a proto-oncogene through inhibition of a ROCK-PTEN pathway. J Pathol. 2014 Oct;234(2):152-63. doi: 10.1002/path.4341. Epub 2014 Aug 6. PMID: 24615293.