Search by BoMiProt ID - Bomi4958


Primary Information

BoMiProt ID Bomi4958
Protein Name Cyclin-dependent kinase 2-interacting protein
Organism Bos taurus
Uniprot IdA6H7E2
Milk FractionWhey,MFGM
Ref Sequence Id NP_001092595.1
Aminoacid Length 212
Molecular Weight 24128
Fasta Sequence https://www.uniprot.org/uniprot/A6H7E2.fasta
Gene Name CINP
Gene Id 613767
Protein Existence Status reviewed

Secondary Information

Protein Function CINP is a cofactor of Krüppel-like factor 5 (KLF5),which egulates cellular processes including cell proliferation and survival by regulating gene expression.Interacts with the components of the replication complex and 2 kinases, CDK2 and CDC7
PTMs Acetylation and phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6H7E2|CINP_BOVIN Cyclin-dependent kinase 2-interacting protein OS=Bos taurus OX=9913 GN=CINP PE=2 SV=1 MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDGGFATANSIANMKISLSS KDKIELASS*69GLAS*73NDCAEKEHPEYSRELETLCEELQATLEGLTKIQMKMEKLSSTTKGVC ELEDYHHGEERKRPPLFHTWPTAHFYEVSRKLSDMYSQELRLKRTVVEQLAHTADRDLAL SYLSMWLHQPYLEAGSWLLLESMLLETGHRVL
Predicted Disorder Regions 1-19, 62-86, 127-135
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Wu Q, Fu C, Li M, Li J, Li Z, Qi L, Ci X, Ma G, Gao A, Fu X, A J, An N, Liu M, Li Y, King JL, Fu L, Zhang B, Dong JT. CINP is a novel cofactor of KLF5 required for its role in the promotion of cell proliferation, survival and tumor growth. Int J Cancer. 2019 Feb 1;144(3):582-594. doi: 10.1002/ijc.31908. Epub 2018 Oct 26. PMID: 30289973; PMCID: PMC6294659.