Search by BoMiProt ID - Bomi4957


Primary Information

BoMiProt ID Bomi4957
Protein Name Cyclin-dependent kinase 13/CDC2-related protein kinase 5/Cell division cycle 2-like protein kinase 5/Cell division protein kinase 13
Organism Bos taurus
Uniprot IdE1BB52
Milk FractionWhey
Ref Sequence Id NP_001192360.1
Aminoacid Length 1512
Molecular Weight 164717
Fasta Sequence https://www.uniprot.org/uniprot/E1BB52.fasta
Gene Name CDK13/CDC2L/CDC2L5
Gene Id 511147
Protein Existence Status reviewed

Secondary Information

Protein Function Ser/Thr protein kinases take part in transcription process.Hyper phosphorylationg CTD domain of Pol-II subunit RPB1.Required for mRNA processing.
Biochemical Properties CTD contains 52 heptapeptide repeats of the consensus sequence YSPTSPS on which serine residues at positions 5 and 2 of the heptapeptide repeat is phosphorylated by this kinase.Interacting cyclin subunit K.CdK 13 contains typical kinase fold consisting of an N-terminal lobe (amino acids 695–794), and a C-terminal lobe (amino acids 795–998) as well as a C-terminal extension segment (amino acids 999–1032).. The catalytic protein kinase domain is 294 amino acids long and extends from position 705 to 998 in the polypeptide chain.Within this domain the lysine residue at position 734 represents the ATP binding site and the aspartate residue at position 837 is the proton acceptor site.The nucleotide-binding site extends from amino acids 711–719 (I-G-E-G-T-Y-G-Q-V).
PTMs Acetylation, Isopeptide bond formation, Phosphorylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|E1BB52|CDK13_BOVIN Cyclin-dependent kinase 13 OS=Bos taurus OX=9913 GN=CDK13 PE=3 SV=1 MPSSSDTALGGGGGLSWAEKKLEERRKRRRFLSPQQPPLLLPLLQPQLLQPPPPPPPLLF LAAPGTAAAAAAAAAASSSCFSPGPPLEVKRLARGKRRAGGRQKRRRGPRAGQEAEKRRV FSLPQPQQDGGGGASSGGGVTPLVEYEDVSSQSEQGLLLGGASAATAATAAGGTGGSGGS PASSSGTQRRGEGSERRPRRDRRSSSGRSKDRHREHRRRDGQRGGGEASKSRSRHGHGGE ERAEAGKSGSSSSSGGRRKSASATSSSSSSRKDRDPKAHRSRTKSSKEPPSAYKEPPKAY REDKTEPKAYRRRQRS*316LS*318PLGGRDDS*326PVSHRASQSLRNRKS*341PS*343PAGGGSSPYSRRLARS*359PS*361PYSRRRSPSYSRHSSYERGGDVS*384PSPYSSSSWRRS*396RS*398PYS*401PVIRRSAKSRSRSPYSSRH SRSRSRHRLSRSRSRHSS*438IS*440PSTLTLKSSLAAELNKNKKARAAEAARAAEAAKAAEAAKA AEAAAKAAKAASTSTPTKGNTETGASASQTNHVKDVKKLKTEHAPS*526PSSGGTLKNDKAKT KPPLQVTKVDNNLIVDKATKKAVVVGKESKSAATKEEPVSLKEKTKPLT*589PSIGAKEKEQH VALVTSTLPPLPLPPMLPEDKDADSLRGNISVKAVKKEVEKKLRCLLADLPLPPELPGGD DLSKSPEEKKTATQLHNKRRPKICGPRFGEIKEKDIDWGKRCVDKFDIIGIIGEGTYGQV YKARDKDTGEMVALKKVRLDNEKEGFPITAIREIKILRQLTHQSIINMKEIVTDKEDALD FKKDKGAFYLVFEYMDHDLMGLLESGLVHFNENHIKSFMRQLMEGLDYCHKKNFLHRDIK CSNILLNNRGQIKLADFGLARLYSSEESRPYT*872NKVITLWYRPPELLLGEERYTPAIDVWS CGCILGELFTKKPIFQANQELAQLELISRICGSPCPAVWPDVIKLPYFNTMKPKKQYRRK LREEFVFIPAAALDLFDYMLALDPSKRCTAEQALQCEFLRDVEPSKMPPPDLPLWQDCHE LWSKKRRRQKQMGMTDDVSTVKAPRKDLS*1049LGMDDSRTST*1059PQSVLPSSQLKPQGNSNAAPV KTGPGQQLNHSELAILLNLLQSKTSVNMADFVQVLNIKVNSETQQQLNKINLPAGILATG EKQTDPSTPQQESSKPLGGIQPSQNMQPKVEPDAAQAAVQSAFAVLLTQLIKAQQSKQKD VLLEERENGSGHEAPLQLRPPPEPATPASGQDDLIQHQDMRLLELT*1246PEPDRPRILPPDQR PPEPPEPPPVTEEDLDYRTENQHVPTTSSSLTDPHAGVKAALLQLLAQHQPQDDPKRESG IDYQAGDTYVPSSDYKDNFGSSSFSSAPYVSNDGLGSASAPPLERRSFMGNSDIQSLDNY STTSSHSGGPPQPSAFSESFPSSVAGYGDIYLNTGPMLFSGDKDHRFEYSHGPIAVLANS SDPSTGPESTHPLPAKMHNYNYGGSLQETPGGHGLMHGQTWTSPAQGPGYSQGYRGHIST SAGRGRGRGLPY
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylated Thr in the kinase T-loop is imp for transcriptional regulation.The formation of three salt bridges between arginine residues from sequentially distant loop sections of the kinase to the phosphorylated threonine of the T-loop is a hallmark of CDK activation.
Additional Comments Mutations in CDK13 have been identified as a novel cause of syndromic intellectual disability.CDK13 is ubiquitously expressed with highest expression in the cerebellum, tibial nerve, endocervix, uterus, fallopian tube,and ovary.
Bibliography Lu H, Yu D, Hansen AS, Ganguly S, Liu R, Heckert A, Darzacq X, Zhou Q. Phase-separation mechanism for C-terminal hyperphosphorylation of RNA polymerase II. Nature. 2018 Jun;558(7709):318-323. doi: 10.1038/s41586-018-0174-3. Epub 2018 May 30. PMID: 29849146; PMCID: PMC6475116. 2.Hamilton MJ, Suri M. CDK13-related disorder. Adv Genet. 2019;103:163-182. doi: 10.1016/bs.adgen.2018.11.001. Epub 2018 Dec 11. PMID: 30904094. 3.Greifenberg AK, Hönig D, Pilarova K, Düster R, Bartholomeeusen K, Bösken CA, Anand K, Blazek D, Geyer M. Structural and Functional Analysis of the Cdk13/Cyclin K Complex. Cell Rep. 2016 Jan 12;14(2):320-31. doi: 10.1016/j.celrep.2015.12.025. Epub 2015 Dec 31. PMID: 26748711.