Search by BoMiProt ID - Bomi4945


Primary Information

BoMiProt ID Bomi4945
Protein Name Cyclic AMP-dependent transcription factor ATF-1
Organism Bos taurus
Uniprot IdQ08DA8
Milk FractionWhey
Ref Sequence Id NP_001068757.1
Aminoacid Length 270
Molecular Weight 29261
Fasta Sequence https://www.uniprot.org/uniprot/Q08DA8.fasta
Gene Name ATF1
Gene Id 506967
Protein Existence Status reviewed

Secondary Information

Protein Function This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Mediates PKA-induced stimulation of CRE-reporter genes.Represses the expression of FTH1 and other antioxidant detoxification genes. Triggers cell proliferation and transformation.
Biochemical Properties This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters.
PTMs  Phosphoprotein, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q08DA8|ATF1_BOVIN Cyclic AMP-dependent transcription factor ATF-1 OS=Bos taurus OX=9913 GN=ATF1 PE=2 SV=1 MEDSHKSNTSETAPQSGSTVQAAHISHIAQQVSSLSESEESQDSSDSIGSSQKTHGILAR RPS*63YRKILKDLSSEDIRGRKGDGENPGVSAVTSMSVPTPIYQTSTGQYIAIAPNGALQLA SPGTDGVQGLQTLTMTNSGSTQQGTTILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQI RTTPSATSLPQTVVMTS*197PVTLTSQTSKTDDPQLKREIRLMKNREAARECRRKKKEYVKCL ENRVAVLENQNKTLIEELKTLKDLYSNKSV
Predicted Disorder Regions 1 disordered segment ; (1-231)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylated at Ser-197 by HIPK2 in response to genotoxic stress.CDK3-mediated phosphorylation at Ser-63 promotes its transactivation and transcriptional activities.
Bibliography Kingsley-Kallesen ML, Kelly D, Rizzino A. Transcriptional regulation of the transforming growth factor-beta2 promoter by cAMP-responsive element-binding protein (CREB) and activating transcription factor-1 (ATF-1) is modulated by protein kinases and the coactivators p300 and CREB-binding protein. J Biol Chem. 1999 Nov 26;274(48):34020-8. doi: 10.1074/jbc.274.48.34020. PMID: 10567368.