Search by BoMiProt ID - Bomi4939


Primary Information

BoMiProt ID Bomi4939
Protein Name C-X-C chemokine receptor type 2(CXCR-2)/High affinity interleukin-8 receptor B(IL-8R B)
Organism Bos taurus
Uniprot IdQ28003
Milk FractionWhey
Ref Sequence Id NP_776785.1
Aminoacid Length 360
Molecular Weight 40625
Fasta Sequence https://www.uniprot.org/uniprot/Q28003.fasta
Gene Name CXCR2/IL8RB
Gene Id 281863
Protein Existence Status reviewed

Secondary Information

Protein Function Acts as Receptor for interleukin-8,thereby activates neutrophils upon binding of IL8 to C-X-C chemokine receptor type 2.Also CXCL1–CXCR2 signalling induces myocardial recruitment of monocytes, which is the key step for initiating Ang II-induced cardiac remodelling.Conserved residues in the carboxy terminal,potentially involved in the binding to PP2A, a phosphatase.
Biochemical Properties is an ELR-positive receptor characterized by a glutamic acid-leucine-arginine (ELR) sequence and has high binding affinity to the chemokine ligands CXCL1 and CXCL2.Residues 311–330 of the C-terminal domain of CXCR2 is responsible for binding to PP2A, a phosphatase.Lys315, Arg317, His318, and Leu320 are important for the receptor binding to the PP2A core enzyme.The integrity of the sequence motif, KFRHGL, is required for the interaction of CXCR2 with PP2A.
PTMs Phosphorylation,Glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q28003|CXCR2_BOVIN C-X-C chemokine receptor type 2 OS=Bos taurus OX=9913 GN=CXCR2 PE=2 SV=1 MTIILKDLSN*10SSILWEGFEDEFGN*24YSGTPPTEDYDYSPCEISTETLNKYAVVVIDALVFL LSLLGNSLVMLVILYSRIGRSVTDVYLLNLAMADLLFAMTLPIWTASKAKGWVFGTPLCK VVSLLKEVNFYSGILLLACISMDRYLAIVHATRTLTQKWHWVKFICLGIWALSVILALPI FIFREAYQPPYSDLVCYEDLGANTTKWRMIMRVLPQTFGFLLPLLVMLFCYGFTLRTLFS AQMGHKHRAMRVIFAVVLVFLLCWLPYNLVLIADTLMRAHVIAETCQRRNDIGRALDATE ILGFLHSCLNPLIYVFIGQKFRHGLLKIMAIHGLISKEFLAKDGRPSFVGSSSGNTSTTL
Predicted Disorder Regions 11-39, 339-360
DisProt Annotation
TM Helix Prediction 6TMHs; (52-74), (85-107), (130-148), (161-183), (217-239), (252-270)
Significance of PTMs Phosphorylated upon ligand binding; which is required for desensitization.phosphorylated receptor is then internalized via clathrin-coated pits into early endosomes and subsequently dephosphorylated by intracellular protein phosphatases.PP2A is involved in the dephosphorylation of CXCR2 and plays an important role in regulating the receptor signaling.
Additional Comments CXCR2 mediates accumulation of pro-inflammatory cells that likely contribute to adverse cardiac remodelling and dysfunction.knocking down the chemokine receptor CXCR2 (IL8RB) alleviates both replicative and oncogene-induced senescence (OIS) and diminishes the DNA-damage response.
Bibliography 1.Wang L, Zhang YL, Lin QY, Liu Y, Guan XM, Ma XL, Cao HJ, Liu Y, Bai J, Xia YL, Du J, Li HH. CXCL1-CXCR2 axis mediates angiotensin II-induced cardiac hypertrophy and remodelling through regulation of monocyte infiltration. Eur Heart J. 2018 May 21;39(20):1818-1831. doi: 10.1093/eurheartj/ehy085. Erratum in: Eur Heart J. 2019 Jan 1;40(1):49. PMID: 29514257. 2.Fan GH, Yang W, Sai J, Richmond A. Phosphorylation-independent association of CXCR2 with the protein phosphatase 2A core enzyme. J Biol Chem. 2001 May 18;276(20):16960-8. doi: 10.1074/jbc.M009292200. Epub 2001 Feb 26. PMID: 11278485; PMCID: PMC2666306.