Search by BoMiProt ID - Bomi4898


Primary Information

BoMiProt ID Bomi4898
Protein Name COUP transcription factor 2/Nuclear receptor subfamily 2 group F member 2/COUP transcription factor II
Organism Bos taurus
Uniprot IdQ9TTR7
Milk FractionWhey
Aminoacid Length 414
Molecular Weight 45557
Fasta Sequence https://www.uniprot.org/uniprot/Q9TTR7.fasta
Gene Name NR2F2
Gene Id 281945
Protein Existence Status reviewed

Secondary Information

Protein Function Ligand-activated transcription factor. Activated by high concentrations of 9-cis-retinoic acid and all-trans-retinoic acid, but not by dexamethasone, cortisol or progesterone
PTMs Phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q9TTR7|COT2_BOVIN COUP transcription factor 2 OS=Bos taurus OX=9913 GN=NR2F2 PE=2 SV=1 MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPAST*51PAQTAAGGQ GGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRN CPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPSHGQFALTNGDPLNCHSYLSG YISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD QVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVE KLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF GKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ
Predicted Disorder Regions (1-89), (147-165)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Xia, B., Hou, L., Kang, H., Chang, W., Liu, Y., Zhang, Y., & Ding, Y. (2020). NR2F2 plays a major role in insulin-induced epithelial-mesenchymal transition in breast cancer cells. BMC cancer, 20(1), 626. https://doi.org/10.1186/s12885-020-07107-6