Search by BoMiProt ID - Bomi4877


Primary Information

BoMiProt ID Bomi4877
Protein Name COP9 signalosome complex subunit 3
Organism Bos taurus
Uniprot IdA6H7B5
Milk FractionExosomes,MFGM
Ref Sequence Id NP_001092374.1
Aminoacid Length 423
Molecular Weight 47799
Fasta Sequence https://www.uniprot.org/uniprot/A6H7B5.fasta
Gene Name COPS3
Gene Id 507932
Protein Existence Status reviewed

Secondary Information

Protein Function Component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes.
PTMs Acetylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A6H7B5|CSN3_BOVIN COP9 signalosome complex subunit 3 OS=Bos taurus OX=9913 GN=COPS3 PE=2 SV=1 MASALEQFVNSVRQLSAQGQMTQLCELINKSGELLAKNLSHLDTVLGALDVQEHSLGVLA VLFVKFSMPSVPDFETLFSQVQLFISTCNGEHIRYATDTFAGLCHQLTNALVERKQPLRG IGVLRQAIDKMQMNTNQLTSVHADLCQLCLLAKCFKPALPYLDVDMVDICKENGAYDAKH FLCYYYYGGMVYTGLKNFERALYFYEQAITTPAMAVSHIMLESYKKYILVSLILLGKVQQ LPKYTSQIVGRFIKPLSNAYHELAQVYSTNNPSELRSLVTKHSEIFTRDNNMGLVKQCLS SLYKKNIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFASINQKDGMVSF HDNPEKYNNPAMLHNIDQEMLKCIELDERLKAMDQEITVNPQFVQKS*407MGS*410QEDDSGNKPS SYS*423
Predicted Disorder Regions 361-370, 398-423
DisProt Annotation
TM Helix Prediction No TM helices