Search by BoMiProt ID - Bomi4848


Primary Information

BoMiProt ID Bomi4848
Protein Name Complement component 1 Q subcomponent-binding protein, mitochondrial
Organism Bos taurus
Uniprot IdQ3T0B6
Milk FractionWhey
Ref Sequence Id NP_001029699.1
Aminoacid Length 278
Molecular Weight 30606
Fasta Sequence https://www.uniprot.org/uniprot/Q3T0B6.fasta
Gene Name C1QBP
Gene Id 518321
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells  tongue muscle 
Protein Function Complement component 1, q subcomponent binding protein (C1QBP), is a multi-compartmental protein with higher mRNA expression reported in breast cancer tissues.So this protein could be a potential proliferative marker in breast cancer.
Biochemical Properties The N-terminal of C1QBP, residues 74–161, are aligned with the cytoplasmic domain of CD44, residues 273–360, 14 amino acids of 88 potential matches appear to be conserved and identical.
PTMs Phosphorylation at Serine,N6-acetylation at Lysine
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3T0B6|C1QBP_BOVIN Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Bos taurus OX=9913 GN=C1QBP PE=2 SV=1 MFQLLRCVPRVLGTAVAGLRAAAPSLPRLQPASRPCARPFGLLSVRARSVQLPGLLKPRG PCACGCGCSGLHTEGDKAFVDFLS*84DEIKEEKKIQKYKSLPKMSGGWELEVNGTEAKLVRK VAGEKITVTFNINNSIPPAFGGEEEEPSQGQKAEEQEPELTSTPNFVVEVTKDGSSKALV LDCHY*185PEDEIGQEDDQS*197DIFS*201IKEVSFQAT*210GESDWKDTNYTLNTDSLDWGLYDHLMDFLADRGVDNTFADELVELSTALEHQEYISFLEDLKGFVKSK
Predicted Disorder Regions 95-97, 135-166, 187-199
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments  Overexpressed C1QBP can enhance metastatic potential of pancreatic cancer cells through IGF-1/IGF-1R signaling pathways.
Bibliography 1.Scully OJ, Yu Y, Salim A, Thike AA, Yip GW, Baeg GH, Tan PH, Matsumoto K, Bay BH. Complement component 1, q subcomponent binding protein is a marker for proliferation in breast cancer. Exp Biol Med (Maywood). 2015 Jul;240(7):846-53. doi: 10.1177/1535370214565075. Epub 2015 Jan 7. PMID: 25573962; PMCID: PMC4935401. 2.Shi H, Fang W, Liu M, Fu D. Complement component 1, q subcomponent binding protein (C1QBP) in lipid rafts mediates hepatic metastasis of pancreatic cancer by regulating IGF-1/IGF-1R signaling. Int J Cancer. 2017 Oct 1;141(7):1389-1401. doi: 10.1002/ijc.30831. Epub 2017 Jun 24. PMID: 28608366.