Primary Information |
---|
BoMiProt ID | Bomi4848 |
---|
Protein Name | Complement component 1 Q subcomponent-binding protein, mitochondrial |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q3T0B6 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_001029699.1 |
---|
Aminoacid Length | 278 |
---|
Molecular Weight | 30606 |
---|
FASTA Sequence |
Download |
---|
Gene Name | C1QBP |
---|
Gene ID | 518321 |
---|
Protein Existence Status | Reviewed |
---|
Secondary Information |
---|
Presence in other biological fluids/tissue/cells | tongue muscle |
---|
Protein Function | Complement component 1, q subcomponent binding protein (C1QBP), is a multi-compartmental protein with higher mRNA expression reported in breast cancer tissues.So this protein could be a potential proliferative marker in breast cancer. |
---|
Biochemical Properties | The N-terminal of C1QBP, residues 74–161, are aligned with the cytoplasmic domain of CD44, residues 273–360, 14 amino acids of 88 potential matches appear to be conserved and identical. |
---|
PTMs | Phosphorylation at Serine,N6-acetylation at Lysine |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3T0B6|C1QBP_BOVIN Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Bos taurus OX=9913 GN=C1QBP PE=2 SV=1
MFQLLRCVPRVLGTAVAGLRAAAPSLPRLQPASRPCARPFGLLSVRARSVQLPGLLKPRG
PCACGCGCSGLHTEGDKAFVDFLS*84DEIKEEKKIQKYKSLPKMSGGWELEVNGTEAKLVRK
VAGEKITVTFNINNSIPPAFGGEEEEPSQGQKAEEQEPELTSTPNFVVEVTKDGSSKALV
LDCHY*185PEDEIGQEDDQS*197DIFS*201IKEVSFQAT*210GESDWKDTNYTLNTDSLDWGLYDHLMDFLADRGVDNTFADELVELSTALEHQEYISFLEDLKGFVKSK
|
---|
Predicted Disorder Regions | 95-97, 135-166, 187-199 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Additional Comments | Overexpressed C1QBP can enhance metastatic potential of pancreatic cancer cells through IGF-1/IGF-1R signaling pathways. |
---|
Bibliography | 1.Scully OJ, Yu Y, Salim A, Thike AA, Yip GW, Baeg GH, Tan PH, Matsumoto K, Bay BH. Complement component 1, q subcomponent binding protein is a marker for proliferation in breast cancer. Exp Biol Med (Maywood). 2015 Jul;240(7):846-53. doi: 10.1177/1535370214565075. Epub 2015 Jan 7. PMID: 25573962; PMCID: PMC4935401. 2.Shi H, Fang W, Liu M, Fu D. Complement component 1, q subcomponent binding protein (C1QBP) in lipid rafts mediates hepatic metastasis of pancreatic cancer by regulating IGF-1/IGF-1R signaling. Int J Cancer. 2017 Oct 1;141(7):1389-1401. doi: 10.1002/ijc.30831. Epub 2017 Jun 24. PMID: 28608366. |