Search by BoMiProt ID - Bomi4845


Primary Information

BoMiProt ID Bomi4845
Protein Name Complement C1q subcomponent subunit A
Organism Bos taurus
Uniprot IdQ5E9E3
Milk Fractionwhey
Ref Sequence Id NP_001014945.1
Aminoacid Length 244
Molecular Weight 25802
Fasta Sequence https://www.uniprot.org/uniprot/Q5E9E3.fasta
Gene Name C1QA
Gene Id 534961
Protein Existence Status reviewed

Secondary Information

Protein Function C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system
Biochemical Properties Interacts (via C-terminus) with CD33; this interaction activates CD33 inhibitory motifs
PTMs Glycosylation, Hydroxylation and Disulphide bond
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q5E9E3|C1QA_BOVIN Complement C1q subcomponent subunit A OS=Bos taurus OX=9913 GN=C1QA PE=2 SV=1 MEAPRGWLVISVLAISLASSVTEDVCRAPDGTHGSAGIPGRPGRPGLK*48GERGEPGAPAIQ TGIRGLK*67GDQGDPGPPGNPGRMGYPGPSGPMGPAGLPGLK*100GTKGSPGNIKDQPRPAFSAV GPNSVSRDNVVVFGKVITNQENVYQN*146NTGRFRCSVPGYYYFTFQVVSNWDICLSIRSSRR DQIQPLGFCDFNSKGFFQVVSGGTVLHLQQGDQVWIEKDPSKGRIYHGSEADSIFSGFLI FPSA
Predicted Disorder Regions 18-109, 117-124
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs O-linked glycans are Glc-Gal disaccharides typically found as secondary modifications of hydroxylated lysines in collagen-like domains
Bibliography Tenner, A. J., & Volkin, D. B. (1986). Complement subcomponent C1q secreted by cultured human monocytes has subunit structure identical with that of serum C1q. The Biochemical journal, 233(2), 451–458. https://doi.org/10.1042/bj2330451