Search by BoMiProt ID - Bomi4798


Primary Information

BoMiProt ID Bomi4798
Protein Name Coiled-coil domain-containing protein 89
Organism Bos taurus
Uniprot IdQ29RS0
Milk FractionWhey
Ref Sequence Id NP_001039897.1
Aminoacid Length 370
Molecular Weight 43415
Fasta Sequence https://www.uniprot.org/uniprot/Q29RS0.fasta
Gene Name CCDC89
Gene Id 538595
Protein Existence Status reviewed

Secondary Information

PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q29RS0|CCD89_BOVIN Coiled-coil domain-containing protein 89 OS=Bos taurus OX=9913 GN=CCDC89 PE=2 SV=2 MPQEESAPRMDT*12PSSEEPLDKQNRKLEDQEEEMGFKELDGLREALANLRGLSEEDKSERA MLCSRIQEQSQLICILKRRSDEALERCQTLELLNTELEEKRLLEAEELKAKNQQAQKLEE RFMTLASNHELMIRFKDEHKRQNAKLREENEKLRLENDQLFSPALKAQEAKVVQLTAQSE ALAKELETLQRKYAHDVCQAQAREQELLELQNRQACAHTEETEQLRMQLQSLQQQQQEAL QQTAKAEQAHSQQNQELRARLQTVTREKEELLLLSMERGRVLQNKQAEIRQLEEKLKMAD VARRHALERFEQEAVAVNSNLRVRELQRRVDGIQAAYDELRLQSEAFKKHSLDLLSKERE LNAKLRHLFP
Predicted Disorder Regions 1-36, 238-248
DisProt Annotation
TM Helix Prediction No TM helices