Search by BoMiProt ID - Bomi4797


Primary Information

BoMiProt ID Bomi4797
Protein Name Coiled-coil domain-containing protein 86
Organism Bos taurus
Uniprot IdQ2TBX7
Milk FractionWhey
Ref Sequence Id NP_001033663.1
Aminoacid Length 354
Molecular Weight 39874
Fasta Sequence https://www.uniprot.org/uniprot/Q2TBX7.fasta
Gene Name CCDC86
Gene Id 540913
Protein Existence Status reviewed

Secondary Information

Protein Function  a nuclear protein expressed in lymphocytes where it regulates T-cell responses.
Biochemical Properties a cytokine-induced protein and known to Interact with hepatitis C virus (HCV) protein NS5A.
PTMs Citrullination, Phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2TBX7|CCD86_BOVIN Coiled-coil domain-containing protein 86 OS=Bos taurus OX=9913 GN=CCDC86 PE=2 SV=1 MDTPLRRSRRLEGLKPES*18PENPTS*24VLRVRRVLVEFESNPKETGEPRS*47PPGLGS*53PSRQPET*60 S*61PGS*64PSLPNGPALGS*75PRKQPELDSGS*86PEGHRDPGLNFPQNQPESS*105PES*108HLLQPKPSEESPKFS*123QNQGEADSELPKSKEEPTPGCPRHQLQQDSGSLEPFPGQKAPGPEPSKPLQELTPRS PGS*183PRDQHEPSKPPAAGEPAREGPAPKKREGS*212S*213AQAPASKKPKEEIPVIPKGKPKSGRVW KDRSKKRFSQMVQDKPLRTSWQRKMKDRQERKLAKDFARHLEEEKERRRQEKKKRRAENL RRRLENERKAEIVQVIRNPAKLKRAKKKQLRSIEKRDTLAQLQKQPPQRPATKV
Predicted Disorder Regions 1-353
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Hoshino A, Fujii H. Redundant promoter elements mediate IL-3-induced expression of a novel cytokine-inducible gene, cyclon. FEBS Letters. 2007 Mar;581(5):975-980. DOI: 10.1016/j.febslet.2007.01.083. PMID: 17300783; PMCID: PMC1839886. 2.Shishkov R, Chervenkov T, Yamashima T, Tonchev AB. Expression of Cyclon/CCDC86, a novel nuclear protein, in the hippocampus of adult non-human primates. J Neuroimmunol. 2013 May 15;258(1-2):96-9. doi: 10.1016/j.jneuroim.2013.02.016. Epub 2013 Mar 23. PMID: 23528659.