Search by BoMiProt ID - Bomi4792


Primary Information

BoMiProt ID Bomi4792
Protein Name Coiled-coil domain-containing protein 106
Organism Bos taurus
Uniprot IdQ1LZ89
Milk Fractionwhey
Ref Sequence Id NP_001073803.1
Aminoacid Length 278
Molecular Weight 31387
Fasta Sequence https://www.uniprot.org/uniprot/Q1LZ89.fasta
Gene Name CCDC106
Gene Id 618485
Protein Existence Status Reviewed

Secondary Information

Protein Function Promotes the degradation of p53/TP53 protein and inhibits its transactivity.
Biochemical Properties contains a bipartite nuclear localization signal
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q1LZ89|CC106_BOVIN Coiled-coil domain-containing protein 106 OS=Bos taurus OX=9913 GN=CCDC106 PE=2 SV=1 MNSRRRPVKKDSEALEISIPFDETPHLDPQIFYSLSPSRGNFEEPSEAASPTAALMNGVR AQLHLALERNSWLQKRIEDLEEERDFLRCQLDKFISSARLDADDHCRGKPGPRRAEGDGR GGTGGEAS*128DPESAASSLSGASEEGSTVERKRQKQKGGPGRRRFGKPKARERQRVKDADGV LCRYKKILGTFQKLKSMSRAFEHHRVDRNTVALTTPIAELLIVAPEKLAEVGEFDPSKER LLEYSRRCFLALDEETLKKVQALKKSKLLLPITYRFKR
Predicted Disorder Regions 1-60, 74-76, 98-173
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Zhang, X., Zheng, Q., Wang, C., Zhou, H., Jiang, G., Miao, Y., Zhang, Y., Liu, Y., Li, Q., Qiu, X., & Wang, E. (2017). CCDC106 promotes non-small cell lung cancer cell proliferation. Oncotarget, 8(16), 26662–26670. https://doi.org/10.18632/oncotarget.15792