Search by BoMiProt ID - Bomi4737


Primary Information

BoMiProt ID Bomi4737
Protein Name Cleavage and polyadenylation specificity factor subunit 5/Nucleoside diphosphate-linked moiety X motif 21/Nudix motif 21
Organism Bos taurus
Uniprot IdQ3ZCA2
Milk FractionWhey
Ref Sequence Id NP_001030408.1
Aminoacid Length 227
Molecular Weight 26227
Fasta Sequence https://www.uniprot.org/uniprot/Q3ZCA2.fasta
Gene Name NUDT21/CPSF5
Gene Id 518859
Protein Existence Status reviewed

Secondary Information

Protein Function RNA processing factor,important for cell fate change.directs differential polyadenylation of over 1,500 transcripts in cells acquiring pluripotency.Component of the cleavage factor Im (CFIm) complex that functions as an activator of the pre-mRNA 3'-end cleavage and polyadenylation processing required for the maturation of pre-mRNA into functional mRNAs.
PTMs Acetylation, Methylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3ZCA2|CPSF5_BOVIN Cleavage and polyadenylation specificity factor subunit 5 OS=Bos taurus OX=9913 GN=NUDT21 PE=2 SV=1 MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLY*40PLTNYTFGTKEPLYEKDSSV AARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEG LKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQ EKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
Predicted Disorder Regions (1-17)
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography Brumbaugh J, Di Stefano B, Wang X, Borkent M, Forouzmand E, Clowers KJ, Ji F, Schwarz BA, Kalocsay M, Elledge SJ, Chen Y, Sadreyev RI, Gygi SP, Hu G, Shi Y, Hochedlinger K. Nudt21 Controls Cell Fate by Connecting Alternative Polyadenylation to Chromatin Signaling. Cell. 2018 Jan 11;172(1-2):106-120.e21. doi: 10.1016/j.cell.2017.11.023. Epub 2017 Dec 14. Erratum in: Cell. 2018 Jan 25;172(3):629-631. PMID: 29249356; PMCID: PMC5766360.