Search by BoMiProt ID - Bomi4719


Primary Information

BoMiProt ID Bomi4719
Protein Name Citrate synthase, mitochondrial/Citrate (Si)-synthase
Organism Bos taurus
Uniprot IdQ29RK1
Milk FractionWhey
Ref Sequence Id NP_001038186.1
Aminoacid Length 466
Molecular Weight 51773
Fasta Sequence https://www.uniprot.org/uniprot/Q29RK1.fasta
Gene Name CS
Gene Id 280682
Protein Existence Status reviewed

Secondary Information

Protein Function Citrate synthase (CS) catalyzes the conversion of oxaloacetate and acetyl coenzyme A into citrate and coenzyme A in the mitochondrial tricarboxylic acid (TCA) cycle.
Biochemical Properties The enzyme citrate synthase is localized in the mitochondrial matrix and thus can be used as a quantitative enzyme marker of intact mitochondrial mass. Given that many molecules and pathways that have important functions in mitochondria are highly conserved between humans and Drosophila.Plant mitochondrial CS, CSY4 from Arabidopsis thaliana (AtCSY4), has been determined and it's structural comparison of AtCSY4 with mitochondrial CSs revealed a high level of similarity.
Significance in milk variation in milk citrate with stage of lactation is related to de novo synthesis of fatty acids.
PTMs N6-Acetylation at Lys, Trimethylation at Lys-395 , Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q29RK1|CISY_BOVIN Citrate synthase, mitochondrial OS=Bos taurus OX=9913 GN=CS PE=1 SV=1 MALLTAAARLFGAKNASCLVLAARHASASSTNLKDILADLIPKEQTRVKAFRQQHGKTVV GQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGYSIPECQKLLPKAKGGEEPLPEGLF WLLVTGQIPTEEQVSWLSQEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAVTALNSEST FARAYSEGINRTKYWELIYEDSMDLIAKLPCVAAKIYRNLYREGSS*226IGAIDPKLDWSHNF TNMLGYTDAQFTELMRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPL HGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQ REFALKHLPQDPMFKLVAQLYKIVPNILLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYY TVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTDGLMKFVDSKSG
Predicted Disorder Regions 457-466
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Trimethylation at Lys-395 by CSKMT decreases citrate synthase activity.
Additional Comments Expression of citrate synthase during germination and in response to light is regulated by methylation of promoters of corresponding genes.
Bibliography 1.Nishio K, Mizushima T. Structural and biochemical characterization of mitochondrial citrate synthase 4 from Arabidopsis thaliana. Acta Crystallogr F Struct Biol Commun. 2020 Mar 1;76(Pt 3):109-115. doi: 10.1107/S2053230X20001521. Epub 2020 Mar 1. PMID: 32133996; PMCID: PMC7057349. 2.Wei P, Liu Q, Xue W, Wang J. A Colorimetric Assay of Citrate Synthase Activity in Drosophila Melanogaster. J Vis Exp. 2020 Jan 16;(155). doi: 10.3791/59454. PMID: 32009637. 3.Eprintsev AT, Fedorin DN, Dobychina MA, Igamberdiev AU. Regulation of expression of the mitochondrial and peroxisomal forms of citrate synthase in maize during germination and in response to light. Plant Sci. 2018 Jul;272:157-163. doi: 10.1016/j.plantsci.2018.04.017. Epub 2018 Apr 21. PMID: 29807587.