Search by BoMiProt ID - Bomi4676


Primary Information

BoMiProt ID Bomi4676
Protein Name Chromatin complexes subunit BAP18/BPTF-associated protein of 18 kDa
Organism Bos taurus
Uniprot IdQ32LD1
Milk FractionWhey
Ref Sequence Id NP_001033181.1
Aminoacid Length 172
Molecular Weight 17960
Fasta Sequence https://www.uniprot.org/uniprot/Q32LD1.fasta
Gene Name BAP18
Gene Id 512885
Protein Existence Status reviewed

Secondary Information

Protein Function  is a coactivator of AR-mediated transcription.up-regulates the expression of a series of putative AR target genes.BAP18 function on the upregulation of Sp1-mediated AR gene expression and AR-induced CYP19A1/FSHR transactivation, maintaining normal hormone transformation in GCs.
Biochemical Properties contain a conserved SANT domain in its N-terminus, a key role in chromatin remodeling as well as histone modification.
PTMs phosphorylation on Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q32LD1|BAP18_BOVIN Chromatin complexes subunit BAP18 OS=Bos taurus OX=9913 GN=BAP18 PE=2 SV=1 MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVADSSPAGAKWTETEIEMLRAAVKRFGDD LNHISCVIKERTVAQIKATVKRKVYEDSGIPLPADS*96PKKGPKKVASGVLSPPPTAPPPSS SSVPEAGGPPIKKQKADVTLSALNDSDANSDLVDIEGLGETPPTKKLNFDQA
Predicted Disorder Regions 1-9, 30-46, 72-77, 82-172
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Wang X, Wang C, Yan G, Kang Y, Sun G, Wang S, Zou R, Sun H, Zeng K, Song H, Liu W, Sun N, Liu W, Zhao Y. BAP18 is involved in upregulation of CCND1/2 transcription to promote cell growth in oral squamous cell carcinoma. EBioMedicine. 2020 Mar;53:102685. doi: 10.1016/j.ebiom.2020.102685. Epub 2020 Feb 27. PMID: 32113162; PMCID: PMC7047197. 2.Tang T, Jiao J, Li D, Sun G, Lin L, Wang C, Wang S, Zou R, Liu W, Zhao Y, Wang X. The function of BAP18 on modulation of androgen receptor action in luteinized granulosa cells from normal weight women with and without PCOS. Mol Cell Endocrinol. 2021 May 1;527:111228. doi: 10.1016/j.mce.2021.111228. Epub 2021 Mar 1. PMID: 33662476.