Search by BoMiProt ID - Bomi4670


Primary Information

BoMiProt ID Bomi4670
Protein Name Choline transporter-like protein 4/Solute carrier family 44 member 4/Thiamine pyrophosphate transporter 1
Organism Bos taurus
Uniprot IdA3KMY4
Milk FractionExosomes
Ref Sequence Id NP_001076911.1
Aminoacid Length 707
Molecular Weight 78938
Fasta Sequence https://www.uniprot.org/uniprot/A3KMY4.fasta
Gene Name SLC44A4/CTL4/TPPT1
Gene Id 520625
Protein Existence Status reviewed

Secondary Information

Presence in other biological fluids/tissue/cells Intestine, kidney, stomach
Protein Function Choline transporter that plays a role in the choline-acetylcholine system and is required to the efferent innervation of hair cells in the olivocochlear bundle for the maintenance of physiological function of outer hair cells and the protection of hair cells from acoustic injury.Also act as thiamine pyrophosphate transporter in colon, may mediate the absorption of microbiota-generated thiamine pyrophosphate and contribute to host thiamine (vitamin B1) homeostasis.
PTMs N-glycosylated
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A3KMY4|CTL4_BOVIN Choline transporter-like protein 4 OS=Bos taurus OX=9913 GN=SLC44A4 PE=2 SV=1 MGGKQDQDKEAYGKPAKYDPSFRGPIRNRSCTDIICCVLFFLFILGYIAVGILAWVYGDP KQVLYPRN*68STGAYCGIGENKEKPYLLYFNIFSCVLNTNIIAIAQNGLKCPTPQVCVSSCP EASWTVEPRQFSQTVEQVFYAANRNFCLPGVPGNMQVLQSLQQELCPSFLLPSTPALGRC FPWTN*185STVPELPGISN*196TSISQSISGLLDSLNARDISVKIFEDFAQSWYWILIALGLALVL SLLFILLLRLVAGPLVFVLIIGVLGVLAYGIYHCWEEYRVLRDKGASISQLGFTTN*296LSAY RNVQETWLAALIILAVLEGVLLLMLIFLRQRICIAIALLKEASRAVGYIMSTMFYPLVTF ALLLVCIAYWAIIALFLATSGQPQYVFWAPN*391SSLPGCEKVPMN*403TSCDPMEQVN*413SSCPGLM CVFQGYQSTGLAQRSLFNLQIYAVLGLFWTINWVLALGQCVLAGAFASFYWAFHKPRDIP TFPLGSAFLRTLRYHTGSLAFGALILTLVQIARVILEYIDHKLRGAQNPLTRCILCCFKC CLWCLEKFIKFLNRNAYIMIAIYGKNFCVSAKNAFMLLMRNIVRVVVLDKVTDLLLFFGK LLVVGGVGVLSFFFFTGRIPSLGKTFENPQLNYYWLPIMVSILGAYLIASGFFSVFGMCV DTLFLCFLEDLERNDGSADRPYYMSKSLLKILGKKNKGTPGDKKRKK
Predicted Disorder Regions 1-15, 694-707
DisProt Annotation
TM Helix Prediction 10TMHs; (35-57),(226-248),(255-273),(306-328),(354-376),(451-473),(494-516),(556-574),(594-616),(635-657)
Significance of PTMs N-glycosylation of Asn-68 and Asn-391 is required for a proper thiamine pyrophosphate uptake.
Additional Comments knockdown of CTL4 significantly decreased ACh secretion. Conversely, an increase in the expression of CTL4 increased ACh secretion.
Bibliography Inazu M. Choline transporter-like proteins CTLs/SLC44 family as a novel molecular target for cancer therapy. Biopharm Drug Dispos. 2014 Nov;35(8):431-49. doi: 10.1002/bdd.1892. Epub 2014 Feb 27. PMID: 24532461.