Search by BoMiProt ID - Bomi4655


Primary Information

BoMiProt ID Bomi4655
Protein Name Chloride channel CLIC-like protein 1
Organism Bos taurus
Uniprot IdQ1LZF8
Milk FractionWhey,MFGM
Ref Sequence Id NP_001069252.1
Aminoacid Length 542
Molecular Weight 61812
Fasta Sequence https://www.uniprot.org/uniprot/Q1LZF8.fasta
Gene Name CLCC1
Gene Id 519085
Protein Existence Status reviewed

Secondary Information

Protein Function They are implicated in cell volume regulation, acidification, and cell cycle regulation.
Biochemical Properties CLICs resemble the omega class of Glutathione S-transferases (GST), yet differ from them in their ability to form ion channels. They are ubiquitously found in eukaryotes but no prokaryotic homolog has been characterized
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q1LZF8|CLCC1_BOVIN Chloride channel CLIC-like protein 1 OS=Bos taurus OX=9913 GN=CLCC1 PE=2 SV=1 MLYSLLLCECLWLITAYAHDDEWIDPTDMLNYDAASGRMRKSQVKYGISEKEEVNPDLSC ANELSECYNRLDSLTYKIDECEKQKRKDYESQSNPVFRRYLNKILIETKKLGLPDENKHD MHYDAEIILKRQTLLEIQKFLSGEDWKPGALDDALSDILINFKFHDFETWKWRFEEFFGV DPYNVFMVLLCLLCIVALVATELWTYVRWYTQLKRVFFISFLISLGWNWMYLYKLAFAQH QAEVAKMEPLNNVCAEKMNWSGSLWEWLRSSWTYKDDPCQKYYELLLVNPIWLVPPTKAL AVTFTNFVTEPLKHVGKGAGEFIKALMKEIPVLLHIPVLIIMALAVLSFCYGAGKSVNML RHVGGPEREAPQALQAGERRRQQKIDYRPHGGAGDADFYYRGQISPIEQGPNDNTYEGRR DVLRERDVGLRFQTGNKS*438PEVLRPFDLQEAEAREHPKVVPGLKS*464PNLESKPREMGEIPGE ST*482PTESSTESSQPAKPVSGQKVSEGVEGCPAVEKAQLRTDAAGGPEEGSTCS*532PASTAVEV CG
Predicted Disorder Regions 393-412, 434-439, 450-542
DisProt Annotation
TM Helix Prediction 3TMHs; (183-205),(216-238),(330-352)
Additional Comments The genome of Arabidopsis thaliana contains unusual members of the glutathione S-transferase (GST) superfamily with a cysteine in place of a serine at the active site. Four of these genes (at-dhar 1-4) have an appreciable homology to intracellular Cl- channels (CLICs) from vertebrates and invertebrates.
Bibliography 1.Elter A, Hartel A, Sieben C, Hertel B, Fischer-Schliebs E, Lüttge U, Moroni A, Thiel G. A plant homolog of animal chloride intracellular channels (CLICs) generates an ion conductance in heterologous systems. J Biol Chem. 2007 Mar 23;282(12):8786-92. doi: 10.1074/jbc.M607241200. Epub 2007 Jan 31. PMID: 17267397. 2.Gururaja Rao S, Ponnalagu D, Sukur S, Singh H, Sanghvi S, Mei Y, Jin DJ, Singh H. Identification and Characterization of a Bacterial Homolog of Chloride Intracellular Channel (CLIC) Protein. Sci Rep. 2017 Aug 17;7(1):8500. doi: 10.1038/s41598-017-08742-z. PMID: 28819106; PMCID: PMC5561075.