Primary Information |
---|
BoMiProt ID | Bomi4641 |
---|
Protein Name | Ceroid-lipofuscinosis neuronal protein 5/Protein CLN5 |
---|
Organism | Bos taurus |
---|
Uniprot Id | Q1ZYR0 |
---|
Milk Fraction | Whey |
---|
Ref Sequence Id | NP_001039764.1 |
---|
Aminoacid Length | 358 |
---|
Molecular Weight | 41227 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/Q1ZYR0.fasta |
---|
Gene Name | CLN5 |
---|
Gene Id | 529186 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | role in lysosome fusiom,regulates localization of Rab7 to endosomal membranes and its activation enable retrograde trafficking of the lysosomal sorting receptors,also recruitment of Vps26 into endosomes. |
---|
Biochemical Properties | consists of 407 amino acids with an N-terminal signal sequence that is cleaved in the ER co-translationally.contains a C-terminal amphipathic helix region that is tightly associated with the membrane |
---|
PTMs | N glycosylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q1ZYR0|CLN5_BOVIN Ceroid-lipofuscinosis neuronal protein 5 OS=Bos taurus OX=9913 GN=CLN5 PE=2 SV=1
MAQVGSAGPGACGRRGAGAGAGPERTTWRWAPALLWLATAAAVAGDPSRRQWPVPYKRFS
FRPEPDPYCQAKYTFCPTGSPIPVMKDDDVIEVFRLQAPVWEFKYGDLLGHLKIMHDAIG
FRSTLTEKN*129YTMEWYELFQLGN*142CTFPHLRPEMNAPFWCNQGAACFFEGIDDSHWKEN*177GTL
VLVATISGGMFNRMAKWVKQDN*202ETGIYYETWTVQASPERGAERWFESYDCSKFVLRTYEK
LAELGADFKKIETN*254YTRIFLYSGEPTYLGN*270ETSVFGPTGN*280KTLALAIKKFYYPFKPHLST
KEFLLSLLQIFDAVVIHREFYLFYNFEYWFLPMKYPFIKITYEEIPLPNRKN*352RTLSGL
|
---|
Predicted Disorder Regions | (1-25) |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | In human CLN5 there are eight N-glycosylation consensus sites (N-X-T/S) present (Asparagine residues on position 179, 192, 227, 252, 304, 320, 330, and 401) and all are utilized, with roles involving proper folding, lysosomal targeting and function.N-glycosylated with both high mannose and complex type sugars,which is imp for proper folding and trafficking to the lysosomes.Proteolytic cleavage at the C terminal which takes place beyond the endoplasmic reticulum, and can occur as early as from the trans Golgi network.The N-terminal portion of CLN5 contains the signal peptide, which is cleaved co-translationally during biosynthesis in the ER. |
---|
Bibliography | 1.De Silva B, Adams J, Lee SY. Proteolytic processing of the neuronal ceroid lipofuscinosis related lysosomal protein CLN5. Exp Cell Res. 2015 Oct 15;338(1):45-53. doi: 10.1016/j.yexcr.2015.08.021. Epub 2015 Sep 3. PMID: 26342652; PMCID: PMC4589533. 2.Mamo A, Jules F, Dumaresq-Doiron K, Costantino S, Lefrancois S. The role of ceroid lipofuscinosis neuronal protein 5 (CLN5) in endosomal sorting. Mol Cell Biol. 2012 May;32(10):1855-66. doi: 10.1128/MCB.06726-11. Epub 2012 Mar 19. PMID: 22431521; PMCID: PMC3347407. |