Search by BoMiProt ID - Bomi4641


Primary Information

BoMiProt ID Bomi4641
Protein Name Ceroid-lipofuscinosis neuronal protein 5/Protein CLN5
Organism Bos taurus
Uniprot IdQ1ZYR0
Milk FractionWhey
Ref Sequence Id NP_001039764.1
Aminoacid Length 358
Molecular Weight 41227
Fasta Sequence https://www.uniprot.org/uniprot/Q1ZYR0.fasta
Gene Name CLN5
Gene Id 529186
Protein Existence Status reviewed

Secondary Information

Protein Function role in lysosome fusiom,regulates localization of Rab7 to endosomal membranes and its activation enable retrograde trafficking of the lysosomal sorting receptors,also recruitment of Vps26 into endosomes.
Biochemical Properties consists of 407 amino acids with an N-terminal signal sequence that is cleaved in the ER co-translationally.contains a C-terminal amphipathic helix region that is tightly associated with the membrane 
PTMs N glycosylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q1ZYR0|CLN5_BOVIN Ceroid-lipofuscinosis neuronal protein 5 OS=Bos taurus OX=9913 GN=CLN5 PE=2 SV=1 MAQVGSAGPGACGRRGAGAGAGPERTTWRWAPALLWLATAAAVAGDPSRRQWPVPYKRFS FRPEPDPYCQAKYTFCPTGSPIPVMKDDDVIEVFRLQAPVWEFKYGDLLGHLKIMHDAIG FRSTLTEKN*129YTMEWYELFQLGN*142CTFPHLRPEMNAPFWCNQGAACFFEGIDDSHWKEN*177GTL VLVATISGGMFNRMAKWVKQDN*202ETGIYYETWTVQASPERGAERWFESYDCSKFVLRTYEK LAELGADFKKIETN*254YTRIFLYSGEPTYLGN*270ETSVFGPTGN*280KTLALAIKKFYYPFKPHLST KEFLLSLLQIFDAVVIHREFYLFYNFEYWFLPMKYPFIKITYEEIPLPNRKN*352RTLSGL
Predicted Disorder Regions (1-25)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs In human CLN5 there are eight N-glycosylation consensus sites (N-X-T/S) present (Asparagine residues on position 179, 192, 227, 252, 304, 320, 330, and 401) and all are utilized, with roles involving proper folding, lysosomal targeting and function.N-glycosylated with both high mannose and complex type sugars,which is imp for proper folding and trafficking to the lysosomes.Proteolytic cleavage at the C terminal which takes place beyond the endoplasmic reticulum, and can occur as early as from the trans Golgi network.The N-terminal portion of CLN5 contains the signal peptide, which is cleaved co-translationally during biosynthesis in the ER.
Bibliography 1.De Silva B, Adams J, Lee SY. Proteolytic processing of the neuronal ceroid lipofuscinosis related lysosomal protein CLN5. Exp Cell Res. 2015 Oct 15;338(1):45-53. doi: 10.1016/j.yexcr.2015.08.021. Epub 2015 Sep 3. PMID: 26342652; PMCID: PMC4589533. 2.Mamo A, Jules F, Dumaresq-Doiron K, Costantino S, Lefrancois S. The role of ceroid lipofuscinosis neuronal protein 5 (CLN5) in endosomal sorting. Mol Cell Biol. 2012 May;32(10):1855-66. doi: 10.1128/MCB.06726-11. Epub 2012 Mar 19. PMID: 22431521; PMCID: PMC3347407.