Search by BoMiProt ID - Bomi4635


Primary Information

BoMiProt ID Bomi4635
Protein Name Ceramide synthase 2/LAG1 longevity assurance homolog 2/Sphingosine N-acyltransferase CERS2
Organism Bos taurus
Uniprot IdQ3ZBF8
Milk FractionWhey
Ref Sequence Id NP_001029839.1
Aminoacid Length 380
Molecular Weight 44903
Fasta Sequence https://www.uniprot.org/uniprot/Q3ZBF8.fasta
Gene Name CERS2/LASS2
Gene Id 539223
Protein Existence Status reviewed

Secondary Information

Protein Function ceramide synthase 2 regulates the levels of the S1P precursor sphingosine. involved in the regulation of S1P gradients and S1P-dependent egress into the circulation.
Biochemical Properties catalyzes the transfer of the acyl chain from acyl-CoA to a sphingoid base, with high selectivity toward very-long-chain fatty acyl-CoA (chain length C22-C27)
PTMs Acetylation,Phosphorylation,
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3ZBF8|CERS2_BOVIN Ceramide synthase 2 OS=Bos taurus OX=9913 GN=CERS2 PE=2 SV=1 MLQTLHDYFWWERLWLPVN*19LTWADLEDRDGRVYAKASDLYITLPLALLFLIIRYFFELYV ATPLAALLNVKEKTRLRAPPNPTLEHFYMTSGKQPKQADVELLSRQSGLSGRQVERWFRR RRNQDRPSLLKKFREASWRFTFYLIAFIAGTAVIVDKPWFYDLRKVWEGYPIQSIIPSQY WYYMIELSFYWSLLFSIASDVKRKDFKEQIIHHVATIILISFSWFANYVRAGTLIMALHD SSDYLLESAKMFNYAGWKNTCNNIFIVFAIVFIITRLVILPFWILHCTLVYPLELYPAFF GYYFFNFMMGVLQLLHIFWAYLILRMAHKFITGKVVEDERS*341DREET*346ES*348S*349EGEEAAAGGGAKNRPLANGHPILNNNHRKND
Predicted Disorder Regions 91-103, 341-380
DisProt Annotation
TM Helix Prediction 5TMHs; (46-68), (136-154), (210-228), (263-285), (300-322)
Significance of PTMs Acetylated. Deacetylation by SIRT3 increases enzyme activity and promotes mitochondrial ceramide accumulation.Deacetylation by SIRT3 increases enzyme activity and promotes mitochondrial ceramide accumulation.Phosphorylated at the C-terminus by CK2, leading to increase the ceramide synthase activity.
Bibliography Rieck M, Kremser C, Jobin K, Mettke E, Kurts C, Gräler M, Willecke K, Kolanus W. Ceramide synthase 2 facilitates S1P-dependent egress of thymocytes into the circulation in mice. Eur J Immunol. 2017 Apr;47(4):677-684. doi: 10.1002/eji.201646623. Epub 2017 Feb 27. PMID: 28198542.