Search by BoMiProt ID - Bomi4616


Primary Information

BoMiProt ID Bomi4616
Protein Name Centromere protein N
Organism Bos taurus
Uniprot IdQ32LL9
Milk FractionWhey
Ref Sequence Id NP_001033188.1
Aminoacid Length 339
Molecular Weight 39411
Fasta Sequence https://www.uniprot.org/uniprot/Q32LL9.fasta
Gene Name CENPN
Gene Id 513551
Protein Existence Status reviewed

Secondary Information

Protein Function plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation.
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q32LL9|CENPN_BOVIN Centromere protein N OS=Bos taurus OX=9913 GN=CENPN PE=2 SV=1 MDETLAEFFRRTILKIPMTEMMTILKTWNFMSENQLQTVNFRQRKESIVQDLVLLCEENH ASLNDAAHLDIIYTQFHRHQKIWDVFQMSKAPGDDIDLFDMEQFKSSFKKILQRALKNVT VSFRDAEENSVWIRIAWGTQYKKPNQYKPAYVVYYSQTPYAFTSSSRLKSNLPLLGQALT VASKHHQIVKMDLRSRYLDSLKAIVFKQYNQSFETHNCTTSLQEGS*226LGLDINMDS*235RIIHE NKVEKERVQRVTQEIFGDYPQPRLEFAQYKLETKFKSDLNGGILAEREEPLRCLVKFSSP HLLEALKSLAPAGIADAPLSPLLTCIPNKGKNYFKIRDK
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices