Search by BoMiProt ID - Bomi4600


Primary Information

BoMiProt ID Bomi4600
Protein Name Cell division cycle-associated protein 2
Organism Bos taurus
Uniprot IdQ29RT4
Milk FractionWhey
Ref Sequence Id NP_001039659.1
Aminoacid Length 1011
Molecular Weight 110998
Fasta Sequence https://www.uniprot.org/uniprot/Q29RT4.fasta
Gene Name CDCA2
Gene Id 515287
Protein Existence Status reviewed

Secondary Information

Protein Function promotes cell growth and inhibits apoptosis.Regulator of chromosome structure during mitosis required for condensin-depleted chromosomes to retain their compact architecture through anaphase.
PTMs Isopeptide bond formation, Phosphorylation, Ubl conjugation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q29RT4|CDCA2_BOVIN Cell division cycle-associated protein 2 OS=Bos taurus OX=9913 GN=CDCA2 PE=2 SV=1 MDTCSQESEPLQTKESPINNAGKTPLVLGNGKLVTPHKQAAEMTPNCYTSETFKSPLNFS TVTVEQLGISPESFVNNSSGKSSPYLKKSRRRSTVGLRGLPETNHLIRFVAEQRSLKNAS LTQTS*125PFQGS*130PALYRNVYSLREQMSAFHLAFNSIKENEKMTDCPEFSEAEGVFKTRGSTK KESLGECQLSEFSAQSSSKRRRLSSPSSS*209DVNLTDAVDLQACGVNMAACPSTDMKCAVET CAGLSQKSSASGLNLQCGCLMNESPLLSELTEASSGIQDAASVEERGSNDAVS*293VDKCTEV STDTAPEVRS*310LVT*313PLCQKDLPSSKTFVLRSVLKKPAVKLCVESLQEHLDNLYNDETCPSL TSSLANSCKEQTAALPNTKKRKRVTFGEDLS*391PEVLDES*398LPANT*403PLRKGQTPVRKKDLSSL SPPLLEQS*428PVPEWLPQPNFDDKEENLENIEPLQVSFAVLSSLNMSSIAETLSGTDTSASS SNHENIAPFRVGRATRTSDRRSKLISFSQESVCNLLNAEAQPCKEKKTNRRKSQESKHAD KVLPRKNRVLKGCKKKKGKGKRKGVQKSLYGERDLASKKPLLS*583PIPELPEVSETPLVGSL VRRTYPDDFNSNGKFEEMMLPKRENLLSQDPEDWQVIQGFNKDNASESCSSDMKSSSSFS NATFEQDANINSIEMDENENIPKAITLESENERKTGTECENS*702HISCTLVTVTPVVSDNPK PDFPLQSQELSAAGQNVENLFQIVKIS*747EDMNIKCEKQSGFSVIPEDKLQTEHLIPDSQKE CDCSEDVLTDQRKVSKSQGEDLGRNSAASCSGVSDRERKYRGHSVGGSDGPGLHLERTNN LQTSYSMSSLVEISLENSELCKDLSDSIEQSLQRTKSETKVRRSLRLQKSLEREGGLVWV SPPPPPASCTSQRTKRRTVGTLDSRGFEPVSSRQDPCTLPSTSSEENGEGFTAAPDASLP GKRRRRS*967FCTSTLANPKSTTQSRGCKRRSFLGQKRENTLQETSRESDLSEN
Predicted Disorder Regions 412-451, 472-497, 538-578, 597-621, 643-739, 763-807, 942-955, 999-1008
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Phosphorylated by CDK1 during cell cycle. role in promoting cell proliferation
Bibliography Feng Y, Qian W, Zhang Y, Peng W, Li J, Gu Q, Ji D, Zhang Z, Wang Q, Zhang D, Sun Y. CDCA2 promotes the proliferation of colorectal cancer cells by activating the AKT/CCND1 pathway in vitro and in vivo. BMC Cancer. 2019 Jun 13;19(1):576. doi: 10.1186/s12885-019-5793-z. PMID: 31196027; PMCID: PMC6567669.