Search by BoMiProt ID - Bomi4599


Primary Information

BoMiProt ID Bomi4599
Protein Name Cell division cycle protein 27 homolog
Organism Bos taurus
Uniprot IdA7Z061
Milk FractionWhey
Ref Sequence Id NP_001098898.1
Aminoacid Length 825
Molecular Weight 91870
Fasta Sequence https://www.uniprot.org/uniprot/A7Z061.fasta
Gene Name CDC27
Gene Id 540660
Protein Existence Status reviewed

Secondary Information

Protein Function Component of the anaphase promoting complex/cyclosome (APC/C),
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A7Z061|CDC27_BOVIN Cell division cycle protein 27 homolog OS=Bos taurus OX=9913 GN=CDC27 PE=2 SV=1 MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSL LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLQNFSSCL PNSCTTLVSNHSLSHRQPETVLTET*205PQDT*209IELNRLNLESSNSKYSLNTDSSVSYIDSAVI SPDT*244VPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPS*291PGDGSYLQN YTNTSSVIDVPPT*313GAPSKKSVARIGQTGTKSVFSQSGNS*339REVTPILVAQTQSSGPQTSTT PQVLSPT*367ITSPPNALPRRSS*389RLFTSDS*387STTKENSKKLKMKFPPKIPNRKTKSKTNKGGIT QPNINDS*427LEIT*431KLDSS*436IIS*439EGKISTIT*447PQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIY STTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPN YAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQ KALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKY KSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAI DKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAES*822DEF
Predicted Disorder Regions 196-209, 244-412, 793-824
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Casein kinase II (CKII) is involved in the phosphorylation of Cdc27 in response to TGF-β signaling.Phosphorylation on Ser-427 and Thr-447 occurs specifically during mitosis.
Bibliography Zhang L, Fujita T, Wu G, Xiao X, Wan Y. Phosphorylation of the anaphase-promoting complex/Cdc27 is involved in TGF-beta signaling. J Biol Chem. 2011 Mar 25;286(12):10041-50. doi: 10.1074/jbc.M110.205518. Epub 2011 Jan 5. PMID: 21209074; PMCID: PMC3060455.