Search by BoMiProt ID - Bomi4598


Primary Information

BoMiProt ID Bomi4598
Protein Name Cell division cycle protein 123 homolog
Organism Bos taurus
Uniprot IdQ2YDG3
Milk FractionWhey
Ref Sequence Id NP_001073743.1
Aminoacid Length 335
Molecular Weight 38923
Fasta Sequence https://www.uniprot.org/uniprot/Q2YDG3.fasta
Gene Name CDC123
Gene Id 514926
Protein Existence Status reviewed

Secondary Information

Protein Function Cdc123 makes an essential contribution to the onset of mRNA translation by assembling the eIF2 complex from its three protein subunits.
Biochemical Properties Mutations of CDC123 lead to an increase of GCN4 expression that is independent of Gcn2 kinase and eIF2-ser52 phosphorylation.
PTMs Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2YDG3|CD123_BOVIN Cell division cycle protein 123 homolog OS=Bos taurus OX=9913 GN=CDC123 PE=2 SV=1 MKKEHVLHCQFSAWYPLFRSLTIKSVILPLPQNVKDYLLDDGTLVVSGREDPPAHSQPDS*60 DDEAEEIQWSDDENTATLTAPEFPEFTTKVQEAINSLGGSVFPKLNWSAPRDAYWIAMNS SLKCKTLSDIFLLFKSSDFITRDFTQPFIHCTDDSPDPCMEYELVLRKWCELIPGAEFRC FVKENKLIGISQRDYTQYYDHISKQKEEICRCIQDFFKKHIQYKFLDEDFVFDIYRDSRG KVWLIDFNPFGEVTDSLLFTWDELLSGTNLKGDFSEEALEQDAPAFRCTNSEVTVQPSPY LSYRLPKDFVDLSTGEDAHKLIDFLKLKRNQQEDD
Predicted Disorder Regions 45-82, 330-335
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Mutations of CDC123 lead to an increase of GCN4 expression that is independent of Gcn2 kinase and eIF2-ser52 phosphorylation.
Bibliography Perzlmaier, A. F.; Richter, F.; Seufert, W. (2013). Translation Initiation Requires Cell Division Cycle 123 (Cdc123) to Facilitate Biogenesis of the Eukaryotic Initiation Factor 2 (eIF2). Journal of Biological Chemistry 288(30), 21537–21546.doi:10.1074/jbc.M113.472290