Primary Information |
---|
BoMiProt ID | Bomi4594 |
---|
Protein Name | Cell division cycle 5-like protein/Cdc5-like protein |
---|
Organism | Bos taurus |
---|
Uniprot Id | Q2KJC1 |
---|
Milk Fraction | Whey |
---|
Ref Sequence Id | NP_001070010.1 |
---|
Aminoacid Length | 802 |
---|
Molecular Weight | 92270 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/Q2KJC1.fasta |
---|
Gene Name | CDC5L |
---|
Gene Id | 767817 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | is a core component of the putative E3 ubiquitin ligase complex containing Prp19/Pso4, Plrg1 and Spf27. This complex has been shown to have a role in pre-messenger RNA splicing from yeast to humans.Cdc5L is required for the S-phase checkpoint in response to replication-fork blocking lesions. |
---|
Biochemical Properties | The putative 802-amino acid protein is significantly homologous to the S. pombe Cdc5 gene product and contains 2 tandem repeats of a helix-turn-helix DNA-binding motif with similarity to Myb-related proteins, 4 consensus nuclear localization signals, a proline-rich, hydrophobic region similar to known activation domains, and 28 potential sites for phosphorylation by intracellular kinases.Cdc5L interacts physically with the cell-cycle checkpoint kinase ataxia-telangiectasia and Rad3-related (ATR) which is required for the S-phase cell-cycle checkpoint. |
---|
PTMs | Phosphorylation,Ubl conjugation,Isopeptide bond formation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q2KJC1|CDC5L_BOVIN Cell division cycle 5-like protein OS=Bos taurus OX=9913 GN=CDC5L PE=2 SV=1
MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKK
TEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDP
RKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEAR
RLAALQKRRELRAAGIEIQKKRKKKRGVDYNAEIPFEKKPALGFYDT*227SEENYQTLDADFR
KLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAP
QIS*303DAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSIALRTPRTPAS*358QD
RILQEAQNLMALTNVDT*377PLKGGLNT*385PLHESDFSGVT*396PQRQVVQT*404PNTVLST*411PFRT*415PS*417HGSEGLT*424PRSGTT*430PKPVINS*437T*438PGRT*442PLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGLLGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILRPLNVEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKG
KTVGFGTNNAEHIAYLEHNPYEKFSKEELKKAQDVLVQEMEVVKQGMSHGELSSEAYNQV
WEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHMTTEAKRAAKMEKKMKIL
LGGYQSRAMGLMKQLNDLWDQIEQAYLELRTFEELKKHEDSAIPRRLECLKEDVQRQQER
EKELQHRYADLLLEKETLKAKF
|
---|
Predicted Disorder Regions | NA |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | phosphorylation of CDC5L at threonines 411 and 438 within recognition sequences for CDKs are required for CDC5L-mediated pre-mRNA splicing. |
---|
Bibliography | 1.Gräub R, Lancero H, Pedersen A, Chu M, Padmanabhan K, Xu XQ, Spitz P, Chalkley R, Burlingame AL, Stokoe D, Bernstein HS. Cell cycle-dependent phosphorylation of human CDC5 regulates RNA processing. Cell Cycle. 2008 Jun 15;7(12):1795-803. doi: 10.4161/cc.7.12.6017. Epub 2008 Jun 25. PMID: 18583928; PMCID: PMC2940709. 2.Zhang N, Kaur R, Akhter S, Legerski RJ. Cdc5L interacts with ATR and is required for the S-phase cell-cycle checkpoint. EMBO Rep. 2009 Sep;10(9):1029-35. doi: 10.1038/embor.2009.122. Epub 2009 Jul 24. PMID: 19633697; PMCID: PMC2750050. |