Search by BoMiProt ID - Bomi4594


Primary Information

BoMiProt ID Bomi4594
Protein Name Cell division cycle 5-like protein/Cdc5-like protein
Organism Bos taurus
Uniprot IdQ2KJC1
Milk FractionWhey
Ref Sequence Id NP_001070010.1
Aminoacid Length 802
Molecular Weight 92270
Fasta Sequence https://www.uniprot.org/uniprot/Q2KJC1.fasta
Gene Name CDC5L
Gene Id 767817
Protein Existence Status reviewed

Secondary Information

Protein Function is a core component of the putative E3 ubiquitin ligase complex containing Prp19/Pso4, Plrg1 and Spf27. This complex has been shown to have a role in pre-messenger RNA splicing from yeast to humans.Cdc5L is required for the S-phase checkpoint in response to replication-fork blocking lesions.
Biochemical Properties The putative 802-amino acid protein is significantly homologous to the S. pombe Cdc5 gene product and contains 2 tandem repeats of a helix-turn-helix DNA-binding motif with similarity to Myb-related proteins, 4 consensus nuclear localization signals, a proline-rich, hydrophobic region similar to known activation domains, and 28 potential sites for phosphorylation by intracellular kinases.Cdc5L interacts physically with the cell-cycle checkpoint kinase ataxia-telangiectasia and Rad3-related (ATR) which is required for the S-phase cell-cycle checkpoint.
PTMs Phosphorylation,Ubl conjugation,Isopeptide bond formation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2KJC1|CDC5L_BOVIN Cell division cycle 5-like protein OS=Bos taurus OX=9913 GN=CDC5L PE=2 SV=1 MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKK TEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKAAQRDNEEETTDDP RKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEAR RLAALQKRRELRAAGIEIQKKRKKKRGVDYNAEIPFEKKPALGFYDT*227SEENYQTLDADFR KLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAP QIS*303DAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSIALRTPRTPAS*358QD RILQEAQNLMALTNVDT*377PLKGGLNT*385PLHESDFSGVT*396PQRQVVQT*404PNTVLST*411PFRT*415PS*417HGSEGLT*424PRSGTT*430PKPVINS*437T*438PGRT*442PLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGLLGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILRPLNVEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKG KTVGFGTNNAEHIAYLEHNPYEKFSKEELKKAQDVLVQEMEVVKQGMSHGELSSEAYNQV WEECYSQVLYLPGQSRYTRANLASKKDRIESLEKRLEINRGHMTTEAKRAAKMEKKMKIL LGGYQSRAMGLMKQLNDLWDQIEQAYLELRTFEELKKHEDSAIPRRLECLKEDVQRQQER EKELQHRYADLLLEKETLKAKF
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs phosphorylation of CDC5L at threonines 411 and 438 within recognition sequences for CDKs are required for CDC5L-mediated pre-mRNA splicing.
Bibliography 1.Gräub R, Lancero H, Pedersen A, Chu M, Padmanabhan K, Xu XQ, Spitz P, Chalkley R, Burlingame AL, Stokoe D, Bernstein HS. Cell cycle-dependent phosphorylation of human CDC5 regulates RNA processing. Cell Cycle. 2008 Jun 15;7(12):1795-803. doi: 10.4161/cc.7.12.6017. Epub 2008 Jun 25. PMID: 18583928; PMCID: PMC2940709. 2.Zhang N, Kaur R, Akhter S, Legerski RJ. Cdc5L interacts with ATR and is required for the S-phase cell-cycle checkpoint. EMBO Rep. 2009 Sep;10(9):1029-35. doi: 10.1038/embor.2009.122. Epub 2009 Jul 24. PMID: 19633697; PMCID: PMC2750050.