Search by BoMiProt ID - Bomi4567


Primary Information

BoMiProt ID Bomi4567
Protein Name CD44 antigen/Extracellular matrix receptor III/HUTCH-I/GP90 lymphocyte homing/adhesion receptor
Organism Bos taurus
Uniprot IdQ29423
Milk FractionExosomes
Aminoacid Length 366
Molecular Weight 40002
Fasta Sequence https://www.uniprot.org/uniprot/Q29423.fasta
Gene Name CD44
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells Mesenteric lymph node and liver
Protein Function CD44 is a cell surface adhesion molecule, which is overexpressed on cancer stem cells. The interaction of CD44 with hyaluronan is responsible for tumor development, metastasis, and expression of the chemoresistant phenotype.
PTMs Disulfide bond formation,N-Linked Glycosylation at Asn, Phosphorylation at Ser/Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q29423|CD44_BOVIN CD44 antigen OS=Bos taurus OX=9913 GN=CD44 PE=2 SV=1 MDTFWWRAAWGLCLVQLSLAQIDLN*25ITCRYAGVFHVEKNGRYSISKTEAADLCKAFN*57STL PTMAQMEAARNIGFETCRYGFIEGHVVIPRIHPNSICAAN*100NTGVYILTSN*110TSQYDTICFN*120 ASAPPGEDCTSVTDLPNAFEGPITITIVNRDGTRYTKKGEYRTNPEDINPSVVSPSSPPD DEMSSGSPSERSTSGGYSIFHTHLPTVHPSRPRRPWSQRAEN*222TSDTRDYGSSHDPSGRSY TTHASESAGHSSGSEEHGAN*260TTSGPMRKPQIPEWLIILASLLALALILAVCIAVNS*296RRRC GQKKKLVINNGNGT*314MEERKPS*321GLNGEASKS*330QEMVHLVNKGSSETPDQFMTADETRNLQNV DMKIGV
Predicted Disorder Regions 125-140, 152-268, 296-303, 311-330, 338-353
DisProt Annotation
TM Helix Prediction 1TMH; (274-296)
Significance of PTMs Activation of PKC results in the dephosphorylation of Ser-330 (constitutive phosphorylation site), and the phosphorylation of Ser-296.N-Linked Glycosylation at Asn leads to the additional structural diversity of CD44
Additional Comments The overexpression of CD44 impedes the cytotoxic effect of chemotherapy medications in various cancers. Therefore, the high expression of CD44 is associated with a poor prognosis in affected patients. 
Bibliography 1.Yaghobi Z, Movassaghpour A, Talebi M, Abdoli Shadbad M, Hajiasgharzadeh K, Pourvahdani S, Baradaran B. The role of CD44 in cancer chemoresistance: A concise review. Eur J Pharmacol. 2021 Jul 15;903:174147. doi: 10.1016/j.ejphar.2021.174147. Epub 2021 May 5. PMID: 33961871. 2.J. Cichy, E. Puré.The liberation of CD44.J. Cell Biol., 161 (2003), pp. 839-843, 10.1083/jcb.200302098. 3.