Search by BoMiProt ID - Bomi4563


Primary Information

BoMiProt ID Bomi4563
Protein Name CD166 antigen/Activated leukocyte cell adhesion molecule/CD_antigen: CD166
Organism Bos taurus
Uniprot IdQ9BH13
Milk FractionWhey
Ref Sequence Id NP_776663.1
Aminoacid Length 583
Molecular Weight 64766
Fasta Sequence https://www.uniprot.org/uniprot/Q9BH13.fasta
Gene Name ALCAM
Gene Id 281614
Protein Existence Status reviewed

Secondary Information

Protein Function Activated leucocyte adhesion molecule (ALCAM) was originally identified as a transmembrane receptor which is involved in T-cell activation and has other still unresolved functions in hematopoiesis, development, inflammation and transendothelial migration of neutrophils. 
Biochemical Properties ALCAM is a member of a subfamily of immunoglobulin receptors with five immunoglobulin-like domains (VVC2C2C2) in the extracellular domain and is expressed in many types of tumors. 
PTMs Disulfide bond formation,N-Linked Glycosylation at Asn
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q9BH13|CD166_BOVIN CD166 antigen OS=Bos taurus OX=9913 GN=ALCAM PE=2 SV=1 MASKAAPSCRLVFCLLISATVLRPGLGWYTVNSAYGDTIIMPCRVDVPQNLMFGKWKYEK PDGSPVFIAFRSSTKKSVQYDDVPEYKDRLN*91LSEN*95YTLSISNAKISDEKRFVCMLVTEDD VFEAPTVVKVFKQPSKPEIVSKAPFLETDKLKKLGECISKDSYPDGN*167ITWYRNGKVLQAL EGAVVIIFRKQMDSVTQLYTMTSSLEYKTTKADIQMPFTCSVTYYGPSGQKTVYSEQAVF DIYYPTEQVTIQVLPSKNAIKEGDN*265ITLKCLGNGNPPPEEFLFYLPGQPEGIRSSNTYTL TDVKRN*306ATGDYKCSLVDKKSMIASAAITVHYLDLSLNPSGEVTKQIGDALPVSCTISASR N*361ATVVWMKDNVKLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKRESLTLIVEGKPQIKM TKKTDPSGLSKTIICHVEGFPKPAIQWTITGSGSVIN*457QTEESPYINGRYYSKIIISPEEN*480 VTLTCTAENQLERTVNSLN*499VSAISIPEHDEADEISDENKEKVNDQAKLIVGIVVGLLLAA LVAGVVYWLYMKKSKTASKHVNKDLGNMEENKKLEENNHKTEA
Predicted Disorder Regions 421-427, 506-521, 557-583
DisProt Annotation
TM Helix Prediction 1TMH-(528-550)
Significance of PTMs  Gal-8 physically interacts with glycosylated ALCAM ectodomain, so for the binding of Gal-8 glycosylation is an important PTM.
Additional Comments CD166 expression indicate advanced T category and N-positive status in colorectal cancer specifically.CD166 acts as a functional marker on both stem cells and osteoblasts.
Bibliography 1.Weidle UH, Eggle D, Klostermann S, Swart GW. ALCAM/CD166: cancer-related issues. Cancer Genomics Proteomics. 2010 Sep-Oct;7(5):231-43. PMID: 20952758. 2.Ni C, Zhang Z, Zhu X, Liu Y, Qu D, Wu P, Huang J, Xu AX. Prognostic value of CD166 expression in cancers of the digestive system: a systematic review and meta-analysis. PLoS One. 2013 Aug 5;8(8):e70958. doi: 10.1371/journal.pone.0070958. PMID: 23940674; PMCID: PMC3733726. 3.Chitteti BR, Bethel M, Kacena MA, Srour EF. CD166 and regulation of hematopoiesis. Curr Opin Hematol. 2013 Jul;20(4):273-80. doi: 10.1097/MOH.0b013e32836060a9. PMID: 23615053. 4.Marisa M. Fernández, Fátima Ferragut, Víctor M. Cárdenas Delgado, Candelaria Bracalente, Alicia I. Bravo, Alejandro J. Cagnoni, Myriam Nuñez, Luciano G. Morosi, Héctor R. Quinta, María V. Espelt, María F. Troncoso, Carlota Wolfenstein-Todel, Karina V. Mariño, Emilio L. Malchiodi, Gabriel A. Rabinovich, María T. Elola, Glycosylation-dependent binding of galectin-8 to activated leukocyte cell adhesion molecule (ALCAM/CD166) promotes its surface segregation on breast cancer cells,Biochimica et Biophysica Acta (BBA) - General Subjects,Volume 1860,Issue 10,2016,Pages 2255-2268,ISSN 0304-4165,doi-:https://doi.org/10.1016/j.bbagen.2016.04.019.