Search by BoMiProt ID - Bomi4562


Primary Information

BoMiProt ID Bomi4562
Protein Name CD151 antigen/CD_antigen: CD151
Organism Bos taurus
Uniprot IdQ3ZBH3
Milk FractionWhey
Ref Sequence Id NP_001030424.1
Aminoacid Length 253
Molecular Weight 27987
Fasta Sequence https://www.uniprot.org/uniprot/Q3ZBH3.fasta
Gene Name CD151
Gene Id 523328
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells adipose tissue
Protein Function CD151 regulates post-adhesion events, that is, cell spreading, migration and invasion including subsequent intravasation and formation of metastasis.
Biochemical Properties CD151 consists of four transmembrane domains, two extracellular (EC1 and EC2) and one intracellular loop, and NH2- and COOH-terminal cytoplasmic domains.CD151 is clustered at the cell membrane in specialized multimeric aggregates, ie, tetraspanin-enriched microdomains.
PTMs N-Linked Glycosylation at Asn, Lipoylation, Palmitoylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3ZBH3|CD151_BOVIN CD151 antigen OS=Bos taurus OX=9913 GN=CD151 PE=2 SV=1 MGEFGEKSTTCGTVCLKYLLFTFNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLAT AYILVVAGIVVMVTGALGCCATFKERRNLLRLYFGLLLIIFLLEIIAGALAYIYYQQLNA ELKENLKDTMTRRYHQPGHEGVTSAVDKLQQEFHCCGSN*159NSRDWQDSEWIHSGEAGGRVV PDSCCKTVVPGCGRRDHASNIYKVEGGCITKLETFIQEHLRIIGAVGLGIACVQVFGMLF TCCLYKSLKLEHY
Predicted Disorder Regions (1-6)
DisProt Annotation
TM Helix Prediction 4TMHs; (20-42),(57-79),(92-114),(222-244)
Significance of PTMs Palmitoylation by ZDHHC2 regulates CD151 expression, association with other tetraspanin family proteins and function in cell adhesion.
Bibliography 1.Sadej R, Grudowska A, Turczyk L, Kordek R, Romanska HM. CD151 in cancer progression and metastasis: a complex scenario. Lab Invest. 2014 Jan;94(1):41-51. doi: 10.1038/labinvest.2013.136. Epub 2013 Nov 18. PMID: 24247563. 2.Fitter S, Tetaz TJ, Berndt MC et al. Molecular cloning of cDNA encoding a novel platelet-endothelial cell tetra-span antigen, PETA-3. Blood 1995;86:1348–1355.