Search by BoMiProt ID - Bomi4556


Primary Information

BoMiProt ID Bomi4556
Protein Name CCHC-type zinc finger nucleic acid binding protein
Organism Bos taurus
Uniprot IdQ3T0Q6
Milk FractionExosomes
Ref Sequence Id NP_001029396.1
Aminoacid Length 170
Molecular Weight 18742
Fasta Sequence https://www.uniprot.org/uniprot/Q3T0Q6.fasta
Gene Name CNBP
Protein Existence Status reviewed

Secondary Information

Protein Function is conserved in eukaryotes and is essential for embryonic development in mammals.CNBP preferentially bound G-rich elements in the target mRNA coding sequences, most of which were previously found to form G-quadruplex and other stable structures in vitro. Functional analyses, including RNA sequencing, ribosome profiling, and quantitative mass spectrometry, revealed that CNBP binding did not influence target mRNA abundance but rather increased their translational efficiency.
Biochemical Properties Binds G-rich elements in target mRNA coding sequences.Prevents G-quadruplex structure formation in vitro, suggesting a role in supporting translation by resolving stable structures on mRNAs.CNBP amino acid sequences show a putative Pro-Glu-Ser-Thr site of proteolysis and several putative phosphorylation sites.
PTMs Acetylation, Methylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3T0Q6|CNBP_BOVIN CCHC-type zinc finger nucleic acid binding protein OS=Bos taurus OX=9913 GN=CNBP PE=2 SV=1 MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGFQFVSSS*42LPDICYRCGESGHLAKDC DLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCYSCGEFGH IQKDCTKVKCYRCGETGHVAINCSKTSEVNCYRCGESGHLARECTIEATA
Predicted Disorder Regions 1-12, 18-38, 46-104, 108-142, 154-156, 161-166
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Acetylation, Methylation, Phosphorylation
Bibliography 1.Benhalevy, D., Gupta, S. K., Danan, C. H., Ghosal, S., Sun, H. W., Kazemier, H. G., Paeschke, K., Hafner, M., & Juranek, S. A. (2017). The Human CCHC-type Zinc Finger Nucleic Acid-Binding Protein Binds G-Rich Elements in Target mRNA Coding Sequences and Promotes Translation. Cell reports, 18(12), 2979–2990. https://doi.org/10.1016/j.celrep.2017.02.080