Search by BoMiProt ID - Bomi4545


Primary Information

BoMiProt ID Bomi4545
Protein Name CCAAT/enhancer-binding protein beta
Organism Bos taurus
Uniprot IdO02755
Milk FractionWhey
Ref Sequence Id NP_789745.1
Aminoacid Length 348
Molecular Weight 36390
Fasta Sequence https://www.uniprot.org/uniprot/O02755.fasta
Gene Name CEBPB
Gene Id 338319
Protein Existence Status reviewed

Secondary Information

Protein Function immune and inflammatory responses.Role in gluconeogenic pathway,adipose tissue differentiation, glucose and insulin metabolism, triacylglycerol metabolism, hepatic steatosis, endoplasmic reticulum stress, and HDL production.C/EBP-β plays an important role in promoting the development and differentiation of both white and brown adipose tissue. C/EBPβ inactivation regulates macrophage foam cell formation in atherogenesis by reducing inflammation, ER stress, and apoptosis and by promoting autophagy and inactivating mTOR.
Biochemical Properties All members of the C/EBP family contain a basic leucine zipper (bZIP) domain at the carboxyl-terminus (C-terminus), which is involved in dimerization and binding to the DNA
Significance in milk critical transcription factors in adipogenesis
PTMs Methylation on Arg ,and Phosphorylation on Ser and Thr.Glycosylation on Ser.Acetylation on Lys.Sumoylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|O02755|CEBPB_BOVIN CCAAT/enhancer-binding protein beta OS=Bos taurus OX=9913 GN=CEBPB PE=3 SV=1 MQRLVVWDPVCLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPADRPGPRPPT GELGSIGEHERAIDFSPYLEPLGAPQAPAPTTASDTFEAAPSAPAPVPASSGQHHDFLSD LFSDDYGGKNCKKAAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFE PADCKRKEEAGAPGGGAAGMAAGFPYALRAYLGYQAVPSGSSGSLST*227S*228S*229SSS*232PPGT*236PSPADAKATPAAAACYAGAAPAPSQVKSKAKKT*269VDKHSDEYKIRRERNNIAVRKS*291RDKAKMRNL ETQHKVLELTGENERLQKKVEQLSREVS*328TLRNLFKTLPEPLLASSGHC
Predicted Disorder Regions 3 disordered segments; (39-141), (160-248), (259-324)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs Acetylation at Lys-43 is imp to transactivate target genes, those associated with adipogenesis and adipocyte function. Deacetylation by HDAC1 represses its transactivation activity. Acetylated by KAT2A and KAT2B within a cluster of lysine residues between amino acids 129-133, this acetylation is strongly induced by glucocorticoid treatment and enhances transactivation activity.O-glycosylated, glycosylation at Ser-228 and Ser-229 prevents phosphorylation on Thr-236, Ser-232 and Thr-227 and DNA binding activity which delays the adipocyte differentiation program.Phosphorylation at Thr-269 enhances transactivation activity.Methylated. Methylation at Arg-3 by CARM1 and at Lys-43 by EHMT2 inhibit transactivation activity. Methylation is probably inhibited by phosphorylation at Thr-236.Sumoylation at Lys-174 is for inhibition of T-cells proliferation.
Additional Comments A decreased hepatic C/EBP-β expression coincides with increased insulin production .C/EBP-β knockout mice die early due to disturbances in glycogen mobilization and consequent hypoglycemia.
Bibliography van der Krieken SE, Popeijus HE, Mensink RP, Plat J. CCAAT/enhancer binding protein β in relation to ER stress, inflammation, and metabolic disturbances. Biomed Res Int. 2015;2015:324815. doi: 10.1155/2015/324815. Epub 2015 Jan 28. PMID: 25699273; PMCID: PMC4324884.