Search by BoMiProt ID - Bomi4533


Primary Information

BoMiProt ID Bomi4533
Protein Name Caveolae-associated protein 4/Muscle-related coiled-coil protein/Muscle-restricted coiled-coil protein
Organism Bos taurus
Uniprot IdA5PJI6
Milk FractionWhey
Ref Sequence Id NP_001096734.2
Aminoacid Length 361
Molecular Weight 41161
Fasta Sequence https://www.uniprot.org/uniprot/A5PJI6.fasta
Gene Name CAVIN4/MURC
Gene Id 528386
Protein Existence Status reviewed

Secondary Information

Protein Function  MURC is involved in the skeletal myogenesis that results from modulation of myogenin expression and ERK activation. MURC may play pivotal roles in the molecular mechanisms of skeletal myogenic differentiation.
Biochemical Properties MURC, a muscle-restricted coiled-coil protein that modulates the Rho/ROCK pathway, induces cardiac dysfunction and conduction disturbance
PTMs Phosphorylation at Ser/Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|A5PJI6|CAVN4_BOVIN Caveolae-associated protein 4 OS=Bos taurus OX=9913 GN=CAVIN4 PE=2 SV=2 MEHNGSASNADKIHQNRLSNVTEDEDQDAALTIVTVLDKVAAIVDSVQASQKRIEERHRV MENAIKSVQIDLLKFSQSHSNTGYVINKLFEKTRKVSAHIKDVKARVEKQQTHVKKVEAK QEEIMKKNKFRVVIFQEEVQCPTSLSVVKDRS*152LTESPEEVDEIFDTPVDLS*171S*172DEEYFVEE SRSARLKKSGKERIDNIKKAFSKENMQKTRQNFDKKVNRIRTRIVTPERRERLRQSGERL RQSGERLKQSGERFKKSISNAAPSREAFKMRSLRKTKDRAVAEGPEEVREMGVDIIARGE ALGPISELYPEALSETDPEEASATHPPQEGGEVST*335PEPLKVTFKPQVKVEDDES*354LLLDLK Q
Predicted Disorder Regions 1-26, 52-60, 100-111, 159-168, 176-361
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Overexpression of MURC in C2C12 myoblasts resulted in the promotion of differentiation with enhanced myogenin expression and ERK activation during differentiation.
Bibliography 1.Tagawa M, Ueyama T, Ogata T, Takehara N, Nakajima N, Isodono K, Asada S, Takahashi T, Matsubara H, Oh H. MURC, a muscle-restricted coiled-coil protein, is involved in the regulation of skeletal myogenesis. Am J Physiol Cell Physiol. 2008 Aug;295(2):C490-8. doi: 10.1152/ajpcell.00188.2008. Epub 2008 May 28. PMID: 18508909. 2.Ogata T, Ueyama T, Isodono K, Tagawa M, Takehara N, Kawashima T, Harada K, Takahashi T, Shioi T, Matsubara H, Oh H. MURC, a muscle-restricted coiled-coil protein that modulates the Rho/ROCK pathway, induces cardiac dysfunction and conduction disturbance. Mol Cell Biol. 2008 May;28(10):3424-36. doi: 10.1128/MCB.02186-07. Epub 2008 Mar 10. PMID: 18332105; PMCID: PMC2423172.