Search by BoMiProt ID - Bomi4493


Primary Information

BoMiProt ID Bomi4493
Protein Name Casein kinase II subunit alpha/CK II alpha
Organism Bos taurus
Uniprot IdP68399
Milk Fractionwhey
Ref Sequence Id NP_777060.2
Aminoacid Length 391
Molecular Weight 45144
Fasta Sequence https://www.uniprot.org/uniprot/P68399.fasta
Gene Name CSNK2A1/CK2A1
Gene Id 282419
Protein Existence Status Reviewed

Secondary Information

Protein Function It regulates different functions such as cell cycle progression, apoptosis and transcription, and viral infection.
Significance in milk Phosphorylation of milk proteins
PTMs Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P68399|CSK21_BOVIN Casein kinase II subunit alpha OS=Bos taurus OX=9913 GN=CSNK2A1 PE=1 SV=1 MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINIT NNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTD FKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAE FYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYD QLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDF LDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGST*344PVSSANMMSGISSVPT*360 PS*362PLGPLAGS*370PVIAAANPLGMPVPAAAGAQQ
Predicted Disorder Regions 6-9, 332-391
DisProt Annotation
TM Helix Prediction no TM helices
Significance of PTMs Phosphorylation does not directly affect casein kinase 2 activity, but may contribute to its regulation by forming binding sites for interacting proteins and/or targeting it to different compartments
Bibliography Litchfield, D. W., Lozeman, F. J., Piening, C., Sommercorn, J., Takio, K., Walsh, K. A., & Krebs, E. G. (1990). Subunit structure of casein kinase II from bovine testis. Demonstration that the alpha and alpha' subunits are distinct polypeptides. The Journal of biological chemistry, 265(13), 7638–7644.