Search by BoMiProt ID - Bomi4491


Primary Information

BoMiProt ID Bomi4491
Protein Name Casein kinase I isoform alpha/CK1
Organism Bos taurus
Uniprot IdP67827
Milk FractionExosomes
Ref Sequence Id NP_777136.1
Aminoacid Length 325
Molecular Weight 37567
Fasta Sequence https://www.uniprot.org/uniprot/P67827.fasta
Gene Name CSNK1A1
Gene Id 282684
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells rumen
Protein Function Casein kinase 1 family of phosphotransferases, a group of structurally related protein kinases that frequently function in tandem with the ubiquitin modification system. 
Biochemical Properties CK1 isoforms are candidates for mediating protein hyperphosphorylation because their phosphotransferase domains selectively recognize acidic amino acid sequences including those containing phospho-amino acids. 
PTMs N-acetylation at Alanine,Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|P67827|KC1A_BOVIN Casein kinase I isoform alpha OS=Bos taurus OX=9913 GN=CSNK1A1 PE=1 SV=1 MASS*4SGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKN LTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKK MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTM LKQKAAQQAASSSGQGQQAQTPTGF
Predicted Disorder Regions 1-11, 307-325
DisProt Annotation
TM Helix Prediction No TM helices
Bibliography 1.Kannanayakal TJ, Mendell JR, Kuret J. Casein kinase 1 alpha associates with the tau-bearing lesions of inclusion body myositis. Neurosci Lett. 2008 Jan 31;431(2):141-5. doi: 10.1016/j.neulet.2007.11.066. Epub 2007 Dec 15. PMID: 18191026; PMCID: PMC2359895. 2.Flotow H GP, Wang AQ, Fiol CJ, Roeske RW, Roach PJ. Phosphate groups as substrate determinants for casein kinase I action. J Biol Chem. 1990;265:14264–14269.