Primary Information |
|---|
| BoMiProt ID | Bomi4491 |
|---|
| Protein Name | Casein kinase I isoform alpha/CK1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | P67827 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_777136.1 |
|---|
| Aminoacid Length | 325 |
|---|
| Molecular Weight | 37567 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CSNK1A1 |
|---|
| Gene ID | 282684 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | rumen |
|---|
| Protein Function | Casein kinase 1 family of phosphotransferases, a group of structurally related protein kinases that frequently function in tandem with the ubiquitin modification system. |
|---|
| Biochemical Properties | CK1 isoforms are candidates for mediating protein hyperphosphorylation because their phosphotransferase domains selectively recognize acidic amino acid sequences including those containing phospho-amino acids. |
|---|
| PTMs | N-acetylation at Alanine,Phosphorylation at Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P67827|KC1A_BOVIN Casein kinase I isoform alpha OS=Bos taurus OX=9913 GN=CSNK1A1 PE=1 SV=1
MASS*4SGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKN
LTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKK
MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTM
LKQKAAQQAASSSGQGQQAQTPTGF
|
|---|
| Predicted Disorder Regions | 1-11, 307-325 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | 1.Kannanayakal TJ, Mendell JR, Kuret J. Casein kinase 1 alpha associates with the tau-bearing lesions of inclusion body myositis. Neurosci Lett. 2008 Jan 31;431(2):141-5. doi: 10.1016/j.neulet.2007.11.066. Epub 2007 Dec 15. PMID: 18191026; PMCID: PMC2359895. 2.Flotow H GP, Wang AQ, Fiol CJ, Roeske RW, Roach PJ. Phosphate groups as substrate determinants for casein kinase I action. J Biol Chem. 1990;265:14264–14269. |
|---|
