Primary Information |
---|
BoMiProt ID | Bomi4491 |
---|
Protein Name | Casein kinase I isoform alpha/CK1 |
---|
Organism | Bos taurus |
---|
Uniprot Id | P67827 |
---|
Milk Fraction | Exosomes |
---|
Ref Sequence Id | NP_777136.1 |
---|
Aminoacid Length | 325 |
---|
Molecular Weight | 37567 |
---|
Fasta Sequence | https://www.uniprot.org/uniprot/P67827.fasta |
---|
Gene Name | CSNK1A1 |
---|
Gene Id | 282684 |
---|
Protein Existence Status | Reviewed |
---|
Secondary Information |
---|
Presence in other biological fluids/tissue/cells | rumen |
---|
Protein Function | Casein kinase 1 family of phosphotransferases, a group of structurally related protein kinases that frequently function in tandem with the ubiquitin modification system. |
---|
Biochemical Properties | CK1 isoforms are candidates for mediating protein hyperphosphorylation because their phosphotransferase domains selectively recognize acidic amino acid sequences including those containing phospho-amino acids. |
---|
PTMs | N-acetylation at Alanine,Phosphorylation at Ser |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P67827|KC1A_BOVIN Casein kinase I isoform alpha OS=Bos taurus OX=9913 GN=CSNK1A1 PE=1 SV=1
MASS*4SGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDFGLAKKYRDNRTRQHIPYREDKN
LTGTARYASINAHLGIEQSRRDDMESLGYVLMYFNRTSLPWQGLKAATKKQKYEKISEKK
MSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTM
LKQKAAQQAASSSGQGQQAQTPTGF
|
---|
Predicted Disorder Regions | 1-11, 307-325 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Bibliography | 1.Kannanayakal TJ, Mendell JR, Kuret J. Casein kinase 1 alpha associates with the tau-bearing lesions of inclusion body myositis. Neurosci Lett. 2008 Jan 31;431(2):141-5. doi: 10.1016/j.neulet.2007.11.066. Epub 2007 Dec 15. PMID: 18191026; PMCID: PMC2359895. 2.Flotow H GP, Wang AQ, Fiol CJ, Roeske RW, Roach PJ. Phosphate groups as substrate determinants for casein kinase I action. J Biol Chem. 1990;265:14264–14269. |