Search by BoMiProt ID - Bomi4465


Primary Information

BoMiProt ID Bomi4465
Protein Name Caprin-1/Cytoplasmic activation- and proliferation-associated protein 1/RNA granule protein 105
Organism Bos taurus
Uniprot IdQ1LZB6
Milk FractionWhey
Aminoacid Length 708
Molecular Weight 78328
Fasta Sequence https://www.uniprot.org/uniprot/Q1LZB6.fasta
Gene Name CAPRIN1/RNG105
Gene Id 535571
Protein Existence Status reviewed

Secondary Information

Protein Function  Caprin-1 is also involved in the regulation of synaptic plasticity.It is is localized in the neuronal RNA granules in dendrites of hippocampal and neocortical pyramidal neurons.Caprin-1 also regulates interferon (IFN)-mediated antiviral innate immune response.
Biochemical Properties contain two highly conserved homologous regions (HR1 and HR2) and C-terminal RGG motifs.a less conserved E-rich region is present between HR1 and HR2.Caprin-1 residues 231-245 were reported to be required for interaction with FMRP,scaffording proteins. 231-245 is located within the 5 helix of the dimerization domain. The negatively charged putative protein binding groove formed by homodimerization of Caprin-1 and the E-rich region C-terminal to the dimerization domain interact with the JEV core protein.
PTMs Acetylation, Glycosylation, Methylation, Phosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q1LZB6|CAPR1_BOVIN Caprin-1 OS=Bos taurus OX=9913 GN=CAPRIN1 PE=2 SV=1 MPSATSHSGS*10GSKSSGPPPPSGSSGNEAGAGAAAPASQHPMTGTGAVQTEAMKQILGVID KKLRNLEKKKGKLDDYQERMNKGERLNQDQLDAVSKYQEVTNNLEFAKELQRS*113FMALSQD IQKTIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEE LSLLDEFYKLADPERDMSLRLNEQYEHASIHLWDLLEGKEKPVCGTTYKALKEIVERVFQ SNYFDSTHNHQNGLCEEEEAASAPTVEDQAAEAEPEPVEEYTEQNEVESTEYVNRQFMAE TQFSSGEKEQVDDWTVETVEVVNSLQQQPQAAS*333PSVPEPHS*341LTPVAQADPLVRRQRVQDL MAQMQGPYNFIQDSMLDFENQTLDPAIVSAQPMNPAQNMDIPQLVCPPVHSESRLAQPNQ VSVQPEATQVPLVSSTSEGYTASQPLYQPSHATDQRPQKEPIDQIQATISLNTDQTTASS SLPAASQPQVFQAGTSKPLHSSGINVNAAPFQSMQTVFNMNAPVPPVNEPETLKQQNQYQ ASYNQSFSSQPHQVEQTELQQEQLQTVVGTYHGSQDQPHQVTGNHQQPPQQNTGFPRSNQ PYYNSRGVSRGGSRGARGLMNGYRGPANGFRGGYDGYRPSFSTNTPNSGYTQSQFSAPRD YSGYQRDGYQQNFKRGSGQSGPRGAPRGRGGPPRPNRGMPQMNTQQVN
Predicted Disorder Regions 1-25, 253-349, 362-382, 400-479, 496-503, 530-595
DisProt Annotation
TM Helix Prediction 9TMHs; (899-917), (928-950), (959-977), (984-1006), (1010-1032),(1098-1116), (1128-1150), (1157-1175), and (1243-1265)
Bibliography Wu Y, Zhu J, Huang X, Zhou X, Du Z. Crystal structure of a dimerization domain of human Caprin-2: similar overall dimeric fold but different molecular surface properties to that of human Caprin-1. J Biomol Struct Dyn. 2019 Sep;37(15):3968-3975. doi: 10.1080/07391102.2018.1532817. Epub 2019 Jan 11. PMID: 30304999; PMCID: PMC6459735.