Search by BoMiProt ID - Bomi4443


Primary Information

BoMiProt ID Bomi4443
Protein Name cAMP-regulated phosphoprotein 21
Organism Bos taurus
Uniprot IdQ7M2N1
Milk FractionWhey
Ref Sequence Id NP_001070418.1
Aminoacid Length 89
Molecular Weight 9641
Fasta Sequence https://www.uniprot.org/uniprot/Q7M2N1.fasta
Gene Name ARPP21
Gene Id 618648
Protein Existence Status reviewed

Secondary Information

Protein Function The phosphorylation of ARPP-21 is likely to mediate some of the intracellular effects of neurotransmitters which stimulate adenylate cyclase in these regions, in particular dopamine and vasoactive intestinal peptide in rat brain.
Biochemical Properties a phosphoprotein substrate for cAMP-dependent protein kinase.The amino acid composition of ARPP-21 showed a high content of glutamic acid/glutamine, and no methionine, tryptophan, tyrosine, phenylalanine, or histidine. ARPP-21 is stable to heat denaturation and to 50% (vol/vol) ethanol treatment and is partially soluble at pH 2. The Mr determined for ARPP-21 by SDS/PAGE is 21,000. The Stokes radius of ARPP-21 is 26.3 A, and the sedimentation coefficient of ARPP-21 is 1.3 S; these values yield a calculated molecular mass of 13,700 Da and a frictional ratio of 1.7, indicative of an elongated tertiary structure. 
PTMs Phosphorylation and Acetylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q7M2N1|ARP21_BOVIN cAMP-regulated phosphoprotein 21 OS=Bos taurus OX=9913 GN=ARPP21 PE=1 SV=1 MSEPGDLSQTIVEEGGPEQETATPENGVIKSES*33LDEEEKLELQRRLVAQNQERRKS*56KSGA GKGKLTRSLAVCEESSARPGGESLQDQTL
Predicted Disorder Regions (1-89)
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs The phosphorylation of ARPP-21 is likely to mediate some of the intracellular effects of neurotransmitters which stimulate adenylate cyclase in these regions, in particular dopamine and vasoactive intestinal peptide.
Bibliography 1.Girault JA, Walaas SI, Hemmings HC Jr, Greengard P. ARPP-21, a cAMP-regulated phosphoprotein enriched in dopamine-innervated brain regions: tissue distribution and regulation of phosphorylation in rat brain. Neuroscience. 1990;37(2):317-25. doi: 10.1016/0306-4522(90)90402-p. PMID: 1966823. 2.Hemmings HC Jr, Greengard P. ARPP-21, a cyclic AMP-regulated phosphoprotein enriched in dopamine-innervated brain regions. I. Purification and characterization of the protein from bovine caudate nucleus. J Neurosci. 1989 Mar;9(3):851-64. doi: 10.1523/JNEUROSCI.09-03-00851.1989. PMID: 2538584; PMCID: PMC6569970.