Primary Information |
|---|
| BoMiProt ID | Bomi4443 |
|---|
| Protein Name | cAMP-regulated phosphoprotein 21 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q7M2N1 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001070418.1 |
|---|
| Aminoacid Length | 89 |
|---|
| Molecular Weight | 9641 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | ARPP21 |
|---|
| Gene ID | 618648 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | The phosphorylation of ARPP-21 is likely to mediate some of the intracellular effects of neurotransmitters which stimulate adenylate cyclase in these regions, in particular dopamine and vasoactive intestinal peptide in rat brain. |
|---|
| Biochemical Properties | a phosphoprotein substrate for cAMP-dependent protein kinase.The amino acid composition of ARPP-21 showed a high content of glutamic acid/glutamine, and no methionine, tryptophan, tyrosine, phenylalanine, or histidine. ARPP-21 is stable to heat denaturation and to 50% (vol/vol) ethanol treatment and is partially soluble at pH 2. The Mr determined for ARPP-21 by SDS/PAGE is 21,000. The Stokes radius of ARPP-21 is 26.3 A, and the sedimentation coefficient of ARPP-21 is 1.3 S; these values yield a calculated molecular mass of 13,700 Da and a frictional ratio of 1.7, indicative of an elongated tertiary structure. |
|---|
| PTMs | Phosphorylation and Acetylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q7M2N1|ARP21_BOVIN cAMP-regulated phosphoprotein 21 OS=Bos taurus OX=9913 GN=ARPP21 PE=1 SV=1
MSEPGDLSQTIVEEGGPEQETATPENGVIKSES*33LDEEEKLELQRRLVAQNQERRKS*56KSGA
GKGKLTRSLAVCEESSARPGGESLQDQTL
|
|---|
| Predicted Disorder Regions | (1-89) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | The phosphorylation of ARPP-21 is likely to mediate some of the intracellular effects of neurotransmitters which stimulate adenylate cyclase in these regions, in particular dopamine and vasoactive intestinal peptide. |
|---|
| Bibliography | 1.Girault JA, Walaas SI, Hemmings HC Jr, Greengard P. ARPP-21, a cAMP-regulated phosphoprotein enriched in dopamine-innervated brain regions: tissue distribution and regulation of phosphorylation in rat brain. Neuroscience. 1990;37(2):317-25. doi: 10.1016/0306-4522(90)90402-p. PMID: 1966823. 2.Hemmings HC Jr, Greengard P. ARPP-21, a cyclic AMP-regulated phosphoprotein enriched in dopamine-innervated brain regions. I. Purification and characterization of the protein from bovine caudate nucleus. J Neurosci. 1989 Mar;9(3):851-64. doi: 10.1523/JNEUROSCI.09-03-00851.1989. PMID: 2538584; PMCID: PMC6569970. |
|---|
