Primary Information | |
---|---|
BoMiProt ID | Bomi4441 |
Protein Name | cAMP-dependent protein kinase catalytic subunit beta |
Organism | Bos taurus |
Uniprot Id | P05131 |
Milk Fraction | Exosomes |
Ref Sequence Id | NP_777010.1 |
Aminoacid Length | 351 |
Molecular Weight | 40594 |
Fasta Sequence | https://www.uniprot.org/uniprot/P05131.fasta |
Gene Name | PRKACB |
Gene Id | 282323 |
Protein Existence Status | Reviewed |
Secondary Information | |
Presence in other biological fluids/tissue/cells | Isoform 2 is mainly expressed in heart and brain. |
Protein Function | Mediates cAMP-dependent signaling triggered by receptor binding to GPCRs. |
Biochemical Properties | At the amino acid level, the two PKA-Cα and PKA-Cβ are 91% identical and the catalytic domains are very similar. Catalyses the following reaction-ATP + L-seryl-[protein] = ADP + H+ + O-phospho-L-seryl-[protein] |
PTMs | Phosphorylation at Ser/Thr,Lipoylation, N-Myristoylation at Gly |
Significance of PTMs | Deamidation proceeds via the so-called beta-aspartyl shift mechanism and yields either 'D-Asp-2' (major) or 'D-isoAsp-2' (minor), in addition to L-isomers. Deamidation occurs after the addition of myristate. |
Linking IDs | Bomi4441 |
Bibliography | 1.Jedrzejewski PT, Girod A, Tholey A, König N, Thullner S, Kinzel V, Bossemeyer D. A conserved deamidation site at Asn 2 in the catalytic subunit of mammalian cAMP-dependent protein kinase detected by capillary LC-MS and tandem mass spectrometry. Protein Sci. 1998 Feb;7(2):457-69. doi: 10.1002/pro.5560070227. PMID: 9521123; PMCID: PMC2143929. 2.Pepperkok R, Hotz-Wagenblatt A, König N, Girod A, Bossemeyer D, Kinzel V. Intracellular distribution of mammalian protein kinase A catalytic subunit altered by conserved Asn2 deamidation. J Cell Biol. 2000 Feb 21;148(4):715-26. doi: 10.1083/jcb.148.4.715. PMID: 10684253; PMCID: PMC2169370. 3.Kinzel V, König N, Pipkorn R, Bossemeyer D, Lehmann WD. The amino terminus of PKA catalytic subunit--a site for introduction of posttranslational heterogeneities by deamidation: D-Asp2 and D-isoAsp2 containing isozymes. Protein Sci. 2000 Nov;9(11):2269-77. doi: 10.1110/ps.9.11.2269. PMID: 11152138; PMCID: PMC2144497. 4.Wiemann S, Kinzel V, Pyerin W. Isoform C beta 2, an unusual form of the bovine catalytic subunit of cAMP-dependent protein kinase. J Biol Chem. 1991 Mar 15;266(8):5140-6. PMID: 2002051. 5. |
Presence in other biological fluids/tissue/cells | Isoform 2 is mainly expressed in heart and brain. |
Protein Function | Mediates cAMP-dependent signaling triggered by receptor binding to GPCRs. |
Biochemical Properties | At the amino acid level, the two PKA-Cα and PKA-Cβ are 91% identical and the catalytic domains are very similar. Catalyses the following reaction-ATP + L-seryl-[protein] = ADP + H+ + O-phospho-L-seryl-[protein] |
PTMs | Phosphorylation at Ser/Thr,Lipoylation, N-Myristoylation at Gly |
Site(s) of PTM(s) N-glycosylation, O-glycosylation, Phosphorylation | >sp|P05131|KAPCB_BOVIN cAMP-dependent protein kinase catalytic subunit beta OS=Bos taurus OX=9913 GN=PRKACB PE=1 SV=2 MGNAATAKKGS*11EVESVKEFLAKAKEDFLKKWENPAPNNAGLEDFERKKTLGTGSFGRVML VKHKATEQY*69YAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMV MEYVPGGEMFSHLRRIGRFS*140EPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGY IQVTDFGFAKRVKGRTWT*198LCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFAT TDWIAIYQRKVEAPFIPKFRGS*322GDTSNFDDY*311EEEDIRVS*339ITEKCGKEFCEF |
Predicted Disorder Regions | 1-15, 22-32, 79-81 |
DisProt Annotation | |
TM Helix Prediction | No TM helices |
Significance of PTMs | Deamidation proceeds via the so-called beta-aspartyl shift mechanism and yields either 'D-Asp-2' (major) or 'D-isoAsp-2' (minor), in addition to L-isomers. Deamidation occurs after the addition of myristate. |
Linking IDs | |
Bibliography | 1.Jedrzejewski PT, Girod A, Tholey A, König N, Thullner S, Kinzel V, Bossemeyer D. A conserved deamidation site at Asn 2 in the catalytic subunit of mammalian cAMP-dependent protein kinase detected by capillary LC-MS and tandem mass spectrometry. Protein Sci. 1998 Feb;7(2):457-69. doi: 10.1002/pro.5560070227. PMID: 9521123; PMCID: PMC2143929. 2.Pepperkok R, Hotz-Wagenblatt A, König N, Girod A, Bossemeyer D, Kinzel V. Intracellular distribution of mammalian protein kinase A catalytic subunit altered by conserved Asn2 deamidation. J Cell Biol. 2000 Feb 21;148(4):715-26. doi: 10.1083/jcb.148.4.715. PMID: 10684253; PMCID: PMC2169370. 3.Kinzel V, König N, Pipkorn R, Bossemeyer D, Lehmann WD. The amino terminus of PKA catalytic subunit--a site for introduction of posttranslational heterogeneities by deamidation: D-Asp2 and D-isoAsp2 containing isozymes. Protein Sci. 2000 Nov;9(11):2269-77. doi: 10.1110/ps.9.11.2269. PMID: 11152138; PMCID: PMC2144497. 4.Wiemann S, Kinzel V, Pyerin W. Isoform C beta 2, an unusual form of the bovine catalytic subunit of cAMP-dependent protein kinase. J Biol Chem. 1991 Mar 15;266(8):5140-6. PMID: 2002051. 5. |