Search by BoMiProt ID - Bomi4439


Primary Information

BoMiProt ID Bomi4439
Protein Name Calumenin
Organism Bos taurus
Uniprot IdQ3T0K1
Milk FractionWhey
Ref Sequence Id NP_001029837.1
Aminoacid Length 315
Molecular Weight 37083
Fasta Sequence https://www.uniprot.org/uniprot/Q3T0K1.fasta
Gene Name CALU
Gene Id 539218
Protein Existence Status Reviewed

Secondary Information

Protein Function Calumenin protein (CP) is located within the endoplasmic reticulum Ca2+ binding proteins, and is important in ER-initiated apoptosis. 
Biochemical Properties Calumenin (mainly calumenin-1/-2) contains a N-terminal signal peptide (19 amino-acids) and multiple EF-hand domains.
PTMs N6-acetylation at Lysine,N-Linked Glycosylation at Asn, Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3T0K1|CALU_BOVIN Calumenin OS=Bos taurus OX=9913 GN=CALU PE=2 SV=1 MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQS*44FDY*47DHDAFLGAEEAKT FDQLT*65PEES*69KERLGMIVDKIDADKDGFVTEGELKSWIKHAQKKYIYDNVENQWQEFDLNQ DGLISWDEYRN*131VTYGTYLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFL HPEEYDYMKDIVVQEPMEDIDKNADGFIDLEEYIGDMYSHDGNADEPEWVKTEREQFVEF RDKNRDGKMDKEET*254KDWILPS*261DYDHAEAEARHLVYES*277DQNKDGKLTKEEIVDKYDLFVGS QATDFGEALVRHDEF
Predicted Disorder Regions 23-38, 85-88, 104-129, 226-229
DisProt Annotation
TM Helix Prediction No TM helices
Additional Comments Calumenin directly interacts with the forth luminal loop of SERCA2, and knockdown of calumenin significantly enhances cytosolic calcium transient amplitude and increases calcium sensitivity of SERCA2.
Bibliography 1.Wang Y, Sun Y, Fu Y, Guo X, Long J, Xuan LY, Wei CX, Zhao M. Calumenin relieves cardiac injury by inhibiting ERS-initiated apoptosis during viral myocarditis. Int J Clin Exp Pathol. 2017 Jul 1;10(7):7277-7284. PMID: 31966567; PMCID: PMC6965232. 2. S.K. Sahoo, T. Kim, G.B. Kang, J.G. Lee, S.H. Eom, H. Kim do, Characterization of calumenin-SERCA2 interaction in mouse cardiac sarcoplasmic reticulum, J.Biol. Chem. 284 (2009) 31109–31121. 3.H. Vorum, H. Hager, B.M. Christensen, S. Nielsen, B. Honore, Human calumenin localizes to the secretory pathway and is secreted to the medium, Exp. Cell Res.248 (1999) 473–481.