Search by BoMiProt ID - Bomi4423


Primary Information

BoMiProt ID Bomi4423
Protein Name Calmegin
Organism Bos taurus
Uniprot IdQ3SYT6
Milk FractionWhey
Ref Sequence Id NP_001029377.1
Aminoacid Length 606
Molecular Weight 69515
Fasta Sequence https://www.uniprot.org/uniprot/Q3SYT6.fasta
Gene Name CLGN
Gene Id 504256
Protein Existence Status reviewed

Secondary Information

Protein Function Calmegin is required for fertilin alpha/beta heterodimerization and sperm fertility.
Biochemical Properties Calmegin is a testis-specific Ca(2+)-binding protein that is homologous to calnexin.
PTMs Phosphorylation at Ser
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3SYT6|CLGN_BOVIN Calmegin OS=Bos taurus OX=9913 GN=CLGN PE=2 SV=1 MRFQGFWLCLGLLFISVNAEFMDDSVEMEDFDENSEETDELSSEIKYKTPQPVGEVYFTE TFDSGRLAGWVLSKAKKDDIDAEISIYDGRWEIEELKENRIPGDRGLVLKSRAKHHAISA VLAKPFIFADKPLVVQYEVNFQDGIDCGGAYIKLLADTDGLNLENFYDKTSYTIMFGPDK CGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKRFFTDRKTHLYTLVMNPDDTFEVLID QIVVNKGSLLEDVVPPINPPKEIEDPTDEKPDDWDERAKIPDASAVKPEDWDESEPPQIV DSSAVKPDGWLDNEPEFIPDPNAEKPFDWNEDMDGEWEAPHISNPACRIGCGEWSPPMID NPKYKGIWRPPMIDNPNYQGIWSPRKIPNPDYFEDNHPFLLTSFRALGLELWSMTSDIYF DNFIICSEKEVADRWAADGWGMKILIENANEPSIFKQLMSATEQRPWLWFIYLLTAALPI ALIGSFCWPRKVKKKYEDVAFEKLDICKPQTKGALEQEVKEEKAALEKPVDLEEEKKQSD GEIVEKEEEGEPEEKS*556EEEIEIIEGQEEGNKS*572NKS*575GS*577EDEMKEADES*587TGS*590GDGPIKS*597VRKRRVRKE
Predicted Disorder Regions 26-54, 261-337, 500-511, 527-606
DisProt Annotation
TM Helix Prediction 1TMH; (466-488)
Additional Comments  The immunoreactivity is completely absent in the calmegin-deficient mutant mouse testis.
Bibliography 1.Yoshinaga K, Tanii I, Toshimori K. Molecular chaperone calmegin localization to the endoplasmic reticulum of meiotic and post-meiotic germ cells in the mouse testis. Arch Histol Cytol. 1999 Aug;62(3):283-93. doi: 10.1679/aohc.62.283. PMID: 10495883. 2.Ikawa M, Nakanishi T, Yamada S, Wada I, Kominami K, Tanaka H, Nozaki M, Nishimune Y, Okabe M. Calmegin is required for fertilin alpha/beta heterodimerization and sperm fertility. Dev Biol. 2001 Dec 1;240(1):254-61. doi: 10.1006/dbio.2001.0462. PMID: 11784061.