Search by BoMiProt ID - Bomi4410


Primary Information

BoMiProt ID Bomi4410
Protein Name Calcium/calmodulin-dependent protein kinase type II subunit delta
Organism Bos taurus
Uniprot IdQ2HJF7
Milk FractionExosomes
Ref Sequence Id NP_001039798.1
Aminoacid Length 488
Molecular Weight 55293
Fasta Sequence https://www.uniprot.org/uniprot/Q2HJF7.fasta
Gene Name CAMK2D
Gene Id 532713
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells longissimus thoracis muscle
Protein Function In the heart, Ca2+/calmodulin-dependent protein kinase II is critically involved in the regulation of Ca2+ homeostasis.
PTMs N-acetylation at Ala,Phosphorylation at Ser/Thr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus OX=9913 GN=CAMK2D PE=2 SV=1 MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQET*287VDCLKKFNARRKL KGAILT*306T*307MLATRNFS*315AKS*318LLKKPDGVKKRKSSSSVQMMES*340T*341ES*343SNT*346T*347IEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALS*414KSNKPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRS GSPTVPIN
Predicted Disorder Regions NA
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs CaMKII delta(2) autophosphorylation may play an important role in PDGF-stimulated VSM cell migration.
Bibliography 1.Pfleiderer PJ, Lu KK, Crow MT, Keller RS, Singer HA. Modulation of vascular smooth muscle cell migration by calcium/ calmodulin-dependent protein kinase II-delta 2. Am J Physiol Cell Physiol. 2004 Jun;286(6):C1238-45. doi: 10.1152/ajpcell.00536.2003. Epub 2004 Feb 4. PMID: 14761894. 2.Hagemann D, Hoch B, Krause EG, Karczewski P. Developmental changes in isoform expression of Ca2+/calmodulin-dependent protein kinase II delta-subunit in rat heart. J Cell Biochem. 1999 Aug 1;74(2):202-10. PMID: 10404390.