Search by BoMiProt ID - Bomi4406


Primary Information

BoMiProt ID Bomi4406
Protein Name Calcium/calmodulin-dependent protein kinase type II subunit beta/CaM kinase II subunit beta/CaMK-II subunit beta
Organism Bos taurus
Uniprot IdQ3MHJ9
Milk FractionWhey
Ref Sequence Id NP_001030434.1
Aminoacid Length 542
Molecular Weight 60482
Fasta Sequence https://www.uniprot.org/uniprot/Q3MHJ9.fasta
Gene Name CAMK2B
Gene Id 525416
Protein Existence Status reviewed

Secondary Information

Protein Function widely expressed in brain.isoform of multisubunit enzyme serine/threonine kinase CaMKII.involved in dendritic spine and synapse formation, neuronal plasticity and regulation of F-actin stabilization at activated synapses
PTMs autophosphorylation
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q3MHJ9|KCC2B_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Bos taurus OX=9913 GN=CAMK2B PE=2 SV=1 MATTVTCTRFTDEYQLY*17EDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT VTPEAKNLINQMLTINPAKRIMAHEALKHPWVCQRSTVASMMHRQET*287VECLKKFNARRKL KGAILT*306T*307MLATRNFSVGRQTTAPATMSTAASGATMGLVEQAKSLLNKKADGVKPQTNSTK NSAAATS*367PKGTLPPAALEPQTTVIHNPVDGIKESSDSTHTTIEDEDTKARKQEIIKITEQ LIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILN PHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAP LQ
Predicted Disorder Regions 323-407, 507-516
DisProt Annotation
TM Helix Prediction No TM helices
Significance of PTMs In response to transient influxes of Ca2+ and in the presence of calmodulin and ATP, CaMKII subunits undergo rapid autophosphorylation at characteristic residues (threonine 286 in CaMKIIα) through intramolecular and/or intermolecular interactions, which enable CaMKII to be active independent of Ca2+/calmodulin
Bibliography Liu XB, Murray KD. Neuronal excitability and calcium/calmodulin-dependent protein kinase type II: location, location, location. Epilepsia. 2012 Jun;53 Suppl 1:45-52. doi: 10.1111/j.1528-1167.2012.03474.x. PMID: 22612808.